Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.21
PubTator Score 4.22

Knowledge Summary

Patent (253)

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.7e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.116 2.7e-06

AA Sequence

MQVSIACTEQNLRSRSSEDRLCGPRPGPGGGNGGPAGGGHGNPPGGGGSGPKARAALVPRPPAPAGALRE      1 - 70
STGRGTGMKYRNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEVYAAGKAERTL     71 - 140
GNILKSKGWRRSSYVITTKIFWGGQAETERGLSRKHIIEGLRGSLERLQLGYVDIVFANRSDPNCPMEEI    141 - 210
VRAMTYVINQGLALYWGTSRWGAAEIMEAYSMARQFNLIPPVCEQAEHHLFQREKVEMQLPELYHKIGVG    211 - 280
SVTWYPLACGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQLGCTVAQLAIA    281 - 350
WCLRSEGVSSVLLGVSSAEQLIEHLGALQVLSQLTPQTVMEIDGLLGNKPHSKK                    351 - 404
//

Text Mined References (6)

PMID Year Title