Property Summary

NCBI Gene PubMed Count 29
PubMed Score 55.62
PubTator Score 33.35

Knowledge Summary

Patent (1,214)

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -2.700 2.2e-03
ependymoma -3.300 1.6e-14
oligodendroglioma -2.000 5.6e-11
glioblastoma -3.900 3.9e-05
osteosarcoma 1.184 1.7e-04
medulloblastoma -3.700 3.6e-07
atypical teratoid / rhabdoid tumor -3.700 2.7e-06
medulloblastoma, large-cell -3.900 9.9e-07
primitive neuroectodermal tumor -2.400 4.5e-04
non-small cell lung cancer -1.622 9.9e-17
lung cancer -1.600 1.1e-04
colon cancer -1.400 6.8e-05
pediatric high grade glioma -3.300 1.8e-05
subependymal giant cell astrocytoma -2.337 4.2e-02
Alzheimer's disease -1.200 4.8e-02
Pick disease -1.700 5.3e-04
Breast cancer -2.000 5.8e-12
ductal carcinoma in situ -1.800 9.8e-03
invasive ductal carcinoma -2.800 1.5e-03
ovarian cancer -1.800 4.3e-08

Gene RIF (7)

PMID Text
24951543 Genetic variations of KCNAB1 and CRYAA are associated with age-related nuclear cataract.
24946104 Protein kinase C inhibition results in a Kv 1.5 and Kv beta 1.3 pharmacology closer to Kv 1.5 channels
21333500 These results support KCNAB1 as a susceptibility gene for lateral temporal epilepsy , in agreement with previous studies showing that this gene may alter susceptibility to focal epilepsy.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18987637 Double-mutant cycle analysis indicates that R5 of Kvbeta1.3 interacts with A501 and T480 of Kv1.5, residues located deep within the pore of the channel.
17913586 Meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MLAARTGAAGSQISEENTKLRRQSGFSVAGKDKSPKKASENAKDSSLSPSGESQLRARQLALLREVEMNW      1 - 70
YLKLCDLSSEHTTVCTTGMPHRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAE     71 - 140
VYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFAN    141 - 210
RPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQ    211 - 280
LPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAER    281 - 350
LGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS     351 - 419
//

Text Mined References (34)

PMID Year Title
24951543 2014 Meta-analysis of genome-wide association studies in multiethnic Asians identifies two loci for age-related nuclear cataract.
24946104 2014 PKC inhibition results in a Kv 1.5 + Kv ?1.3 pharmacology closer to Kv 1.5 channels.
21333500 2011 Association of intronic variants of the KCNAB1 gene with lateral temporal epilepsy.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19713757 The molecular basis for the actions of KVbeta1.2 on the opening and closing of the KV1.2 delayed rectifier channel.
18987637 2008 Structural determinants of Kvbeta1.3-induced channel inactivation: a hairpin modulated by PIP2.
17913586 2007 Multicentre search for genetic susceptibility loci in sporadic epilepsy syndrome and seizure types: a case-control study.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
17540341 2007 NADPH binding to beta-subunit regulates inactivation of voltage-gated K(+) channels.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17156368 2006 Episodic ataxia type 1 mutations in the KCNA1 gene impair the fast inactivation properties of the human potassium channels Kv1.4-1.1/Kvbeta1.1 and Kv1.4-1.1/Kvbeta1.2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361858 2004 Control of human potassium channel inactivation by editing of a small mRNA hairpin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14592966 2003 Nogo-A at CNS paranodes is a ligand of Caspr: possible regulation of K(+) channel localization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12130714 2002 Modulation of the human Kv1.5 channel by protein kinase C activation: role of the Kvbeta1.2 subunit.
12077175 2002 Episodic ataxia type 1 mutations in the human Kv1.1 potassium channel alter hKvbeta 1-induced N-type inactivation.
11401852 2001 KChAP/Kvbeta1.2 interactions and their effects on cardiac Kv channel expression.
10756096 2000 Statistical analysis of the 5' untranslated region of human mRNA using "Oligo-Capped" cDNA libraries.
9857044 1998 Coexpression of the KCNA3B gene product with Kv1.5 leads to a novel A-type potassium channel.
9763623 1998 Separable effects of human Kvbeta1.2 N- and C-termini on inactivation and expression of human Kv1.4.
9341123 1997 Human homologue of the Drosophila discs large tumor suppressor binds to p56lck tyrosine kinase and Shaker type Kv1.3 potassium channel in T lymphocytes.
8938711 1996 Structural and functional characterization of human potassium channel subunit beta 1 (KCNA1B).
8838324 1996 Localization of two potassium channel beta subunit genes, KCNA1B and KCNA2B.
8636142 1996 Selective interaction of voltage-gated K+ channel beta-subunits with alpha-subunits.
8001150 1994 Shaker K+ channel beta subunits belong to an NAD(P)H-dependent oxidoreductase superfamily.
7890764 1995 A novel beta subunit increases rate of inactivation of specific voltage-gated potassium channel alpha subunits.
7890032 1995 Molecular cloning and functional expression of a novel potassium channel beta-subunit from human atrium.
7649300 1995 Alternative splicing of the human Shaker K+ channel beta 1 gene and functional expression of the beta 2 gene product.
7603988 1995 Characterization of a voltage-gated K+ channel beta subunit expressed in human heart.
7499366 1995 A novel K+ channel beta-subunit (hKv beta 1.3) is produced via alternative mRNA splicing.