Property Summary

NCBI Gene PubMed Count 10
PubMed Score 36.25
PubTator Score 21.44

Knowledge Summary

Patent (1,758)

TINX Plot

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18474843 The spectrum of neurologic manifestations and neoplasms associated with voltage-gated potassium channel (VGKC) autoimmunity is broader than previously recognized
18162557 analysis of how the RCK2 domain of the human BKCa channel is a calcium sensor

AA Sequence

MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGCCSSERLVINISGLRFETQLRTLSLFPDTLLGDP      1 - 70
GRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFLEEIRFYQLGDEALAAFREDEGC     71 - 140
LPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRVDGRGGNNGG    141 - 210
VSRVSPVSRGSQEEEEDEDDSYTFHHGITPGEMGTGGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLV    211 - 280
RFSACPSKPAFFRNIMNIIDLVAIFPYFITLGTELVQQQEQQPASGGGGQNGQQAMSLAILRVIRLVRVF    281 - 350
RIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTM    351 - 420
TTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHVTCGQPAPDLR    421 - 490
ATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV                                   491 - 529
//

Text Mined References (11)

PMID Year Title
27619418 2016 Pore size matters for potassium channel conductance.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18474843 2008 Clinical spectrum of voltage-gated potassium channel autoimmunity.
18162557 2008 The RCK2 domain of the human BKCa channel is a calcium sensor.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14575698 2003 Human Kv1.6 current displays a C-type-like inactivation when re-expressed in cos-7 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8821794 1995 Characterization of a voltage-activated K-channel gene cluster on human chromosome 12p13.
2347305 1990 Cloning and expression of a human voltage-gated potassium channel. A novel member of the RCK potassium channel family.