Property Summary

Ligand Count 4
NCBI Gene PubMed Count 10
PubMed Score 36.75
PubTator Score 21.44

Knowledge Summary

Patent (1,758)


  Disease (3)

Gene RIF (3)

AA Sequence

ATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV                                   491 - 529

Text Mined References (11)

PMID Year Title