Property Summary

NCBI Gene PubMed Count 43
PubMed Score 192.01
PubTator Score 108.35

Knowledge Summary

Patent (10,492)

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 2.200 1.2e-19
pituitary cancer 1.300 7.2e-05

Gene RIF (12)

PMID Text
22560931 Expression of Kv1.4 appears to increase in the spinal cord of mice modelling remitting-relapsing experimental allergic encephalomyelitis (rrEAE) in peak and remitting phases.
21945024 Detection of the methylation prevalence of KCNA4 and CYP26B1 together in serum demonstrated the good sensitivity and specificityin gastric cancer
21307345 Data suggest that episodic ataxia type 1 mutations affect fast inactivation of Kv1.1/1.4 channels by a reduction in either subunit surface expression or altered affinity for the inactivation domain.
19961828 Sialylated N-glycans uniquely impact gating of a mammalian Shaker family K(v) channel isoform, K(v)1.5, but have no effect on gating of a second Shaker isoform, K(v)1.4.
19453640 Both arachidonic acid and Trolox potently modulate Kv1.4 and Kv4.2 channel alpha-subunits, thereby presumably tuning presynaptic transmitter release and postsynaptic somatodendritic excitability in synaptic transmission and plasticity.
18640987 Thr-330 of Kv1.4 serves to interlock the voltage-sensing and gating domains of adjacent monomers, thereby yielding a structure competent for the surface expression of functional tetramers
17959711 Ginsenoside Rg3 inhibits KV1.4 channel currents by interacting with the lysine531 residue.
17156368 The results demonstrate that the human Kvbeta1.1 and Kvbeta1.2 subunits regulate the proportion of wild-type Kv1.4-1.1 channels that are available to open.
16308273 Fast inactivation in human Kv1.4 is modulated by structural elements in the C-terminus, suggesting that the process involves the concerted action of the N- and C-termini.
15955806 Novel role for GIP in regulating K(V)1.4 cell surface expression and modulation of A-type potassium currents
15136567 Results describe an erbstatin (Erb) analogue as a small molecule inhibitor of the N-type inactivation in potassium channels Kv1.4 and Kv1.1+Kvbeta1.
12065763 N-type inactivation in hKv1.4 is regulated by pH(i) in the physiologic range through ionization of specific amino acid residues in the ball domain.

AA Sequence

MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGGSHHHHQSRGA      1 - 70
CTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRELSEEEEDEEEEEEEEEEGRF     71 - 140
YYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQ    141 - 210
YFDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEE    211 - 280
DRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHGGL    281 - 350
LNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLG    351 - 420
TDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVI    421 - 490
LFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVLTIALPVPVIV    491 - 560
SNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQ    561 - 630
GKGDDSETDKNNCSNAKAVETDV                                                   631 - 653
//

Text Mined References (45)

PMID Year Title
27619418 2016 Pore size matters for potassium channel conductance.
22560931 2012 K+ channel alterations in the progression of experimental autoimmune encephalomyelitis.
21945024 2011 Hypermethylated DNA as potential biomarkers for gastric cancer diagnosis.
21307345 2011 Episodic ataxia type 1 mutations affect fast inactivation of K+ channels by a reduction in either subunit surface expression or affinity for inactivation domain.
19968958 2010 Potassium channel regulator KCNRG regulates surface expression of Shaker-type potassium channels.
19961828 2010 N-glycans modulate K(v)1.5 gating but have no effect on K(v)1.4 gating.
19912772 1990 Human potassium channel genes: Molecular cloning and functional expression.
19453640 2009 Arachidonic acid potently inhibits both postsynaptic-type Kv4.2 and presynaptic-type Kv1.4 IA potassium channels.
18640987 2008 Identification of an evolutionarily conserved extracellular threonine residue critical for surface expression and its potential coupling of adjacent voltage-sensing and gating domains in voltage-gated potassium channels.
17959711 2008 Ginsenoside Rg3 inhibits human Kv1.4 channel currents by interacting with the Lys531 residue.
17156368 2006 Episodic ataxia type 1 mutations in the KCNA1 gene impair the fast inactivation properties of the human potassium channels Kv1.4-1.1/Kvbeta1.1 and Kv1.4-1.1/Kvbeta1.2.
16637659 2006 Uncovering quantitative protein interaction networks for mouse PDZ domains using protein microarrays.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16308273 N type rapid inactivation in human Kv1.4 channels: functional role of a putative C-terminal helix.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15955806 2005 A novel mechanism for the suppression of a voltage-gated potassium channel by glucose-dependent insulinotropic polypeptide: protein kinase A-dependent endocytosis.
15136567 2004 Disinactivation of N-type inactivation of voltage-gated K channels by an erbstatin analogue.
12860415 2003 SAP97 increases Kv1.5 currents through an indirect N-terminal mechanism.
12435606 2002 N-terminal PDZ-binding domain in Kv1 potassium channels.
12065763 2002 Molecular determinants of intracellular pH modulation of human Kv1.4 N-type inactivation.
11997254 2002 Inward rectifier K+ channel Kir2.3 is localized at the postsynaptic membrane of excitatory synapses.
11937501 2002 Selectivity and promiscuity of the first and second PDZ domains of PSD-95 and synapse-associated protein 102.
11744724 2002 The PDZ1 domain of SAP90. Characterization of structure and binding.
11723117 2002 Ligand binding of the second PDZ domain regulates clustering of PSD-95 with the Kv1.4 potassium channel.
11389904 2001 A discrete amino terminal domain of Kv1.5 and Kv1.4 potassium channels interacts with the spectrin repeats of alpha-actinin-2.
11352924 2001 Interaction of gamma 1-syntrophin with diacylglycerol kinase-zeta. Regulation of nuclear localization by PDZ interactions.
10428758 1999 Mutations in the KCNA1 gene associated with episodic ataxia type-1 syndrome impair heteromeric voltage-gated K(+) channel function.
10428084 1999 Subunit composition of Kv1 channels in human CNS.
9786987 1998 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A.
9581762 1998 CRIPT, a novel postsynaptic protein that binds to the third PDZ domain of PSD-95/SAP90.
9024696 1997 GKAP, a novel synaptic protein that interacts with the guanylate kinase-like domain of the PSD-95/SAP90 family of channel clustering molecules.
9000078 1997 NMR structure of inactivation gates from mammalian voltage-dependent potassium channels.
8938729 1996 Differential K+ channel clustering activity of PSD-95 and SAP97, two related membrane-associated putative guanylate kinases.
8601796 1996 Interaction between the C terminus of NMDA receptor subunits and multiple members of the PSD-95 family of membrane-associated guanylate kinases.
8495559 1993 Heteromultimeric assembly of human potassium channels. Molecular basis of a transient outward current?
8449523 1993 Assignment of human potassium channel gene KCNA4 (Kv1.4, PCN2) to chromosome 11q13.4-->q14.1.
7905852 1993 Chromosomal mapping in the mouse of eight K(+)-channel genes representing the four Shaker-like subfamilies Shaker, Shab, Shaw, and Shal.
7477295 1995 Clustering of Shaker-type K+ channels by interaction with a family of membrane-associated guanylate kinases.
2263489 1990 Sequence of a human fetal skeletal muscle potassium channel cDNA related to RCK4.
2001794 1991 Molecular cloning and characterization of two voltage-gated K+ channel cDNAs from human ventricle.
1986382 1991 Sequence and functional expression in Xenopus oocytes of a human insulinoma and islet potassium channel.
1487251 1992 The potassium channel gene HK1 maps to human chromosome 11p14.1, close to the FSHB gene.
1362562 1992 PCR detection of two RFLPs in exon I of the alpha-L-iduronidase (IDUA) gene.