Property Summary

Ligand Count 10
NCBI Gene PubMed Count 62
PubMed Score 343.28
PubTator Score 203.28

Knowledge Summary

Patent (41,091)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.500 2.0e-07
astrocytic glioma -2.200 1.6e-03
Astrocytoma, Pilocytic -1.400 3.2e-06
atypical teratoid / rhabdoid tumor -4.600 8.9e-12
ependymoma -1.100 1.8e-02
glioblastoma -2.100 9.3e-07
group 3 medulloblastoma -5.000 1.8e-10
medulloblastoma, large-cell -4.500 7.7e-07
oligodendroglioma -1.400 9.5e-12
osteosarcoma 1.256 2.4e-06
primitive neuroectodermal tumor -2.400 1.2e-03
subependymal giant cell astrocytoma -2.481 8.3e-03

Gene RIF (28)

AA Sequence

MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFD      1 - 70
PLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPL     71 - 140
PENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTI    141 - 210
GYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPED    211 - 280
AQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE    281 - 350
ADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE    351 - 420
TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYV    421 - 490
NITKMLTDV                                                                 491 - 499
//

Text Mined References (72)

PMID Year Title