Property Summary

Ligand Count 14
NCBI Gene PubMed Count 69
PubMed Score 379.07
PubTator Score 306.36

Knowledge Summary

Patent (8,121)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.500 7.0e-04
astrocytic glioma -2.600 1.1e-03
Astrocytoma, Pilocytic -2.200 2.7e-04
atypical teratoid / rhabdoid tumor -1.400 3.3e-07
ependymoma -3.000 4.8e-04
glioblastoma -3.000 7.2e-08
invasive ductal carcinoma -1.657 4.8e-03
medulloblastoma, large-cell -1.200 3.8e-03
oligodendroglioma -2.300 3.9e-03
primitive neuroectodermal tumor -1.600 7.3e-05
sonic hedgehog group medulloblastoma -2.800 1.8e-03

Gene RIF (37)

AA Sequence

MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRM      1 - 70
RYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEE     71 - 140
ERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILISIVIFCLETLPELKDDKDFTGTVHRIDNTTV    141 - 210
IYNSNIFTDPFFIVETLCIIWFSFELVVRFFACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQ    211 - 280
KGEQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAE    281 - 350
EAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE    351 - 420
GEEQAQLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSK    421 - 490
LLTDV                                                                     491 - 495
//

Text Mined References (74)

PMID Year Title