Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.22
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.100 2.4e-04
hepatocellular carcinoma 1.600 2.6e-05
osteosarcoma -1.331 4.8e-03
atypical teratoid / rhabdoid tumor -1.500 1.3e-04
glioblastoma -1.900 4.4e-05
medulloblastoma, large-cell -1.300 3.0e-05
adrenocortical carcinoma -1.024 1.3e-03
pancreatic ductal adenocarcinoma liver m... -1.553 7.3e-03
tuberculosis and treatment for 3 months -1.400 1.2e-04
sarcoidosis 1.100 5.2e-03
adult high grade glioma -1.200 1.7e-02
aldosterone-producing adenoma -1.280 9.3e-03
subependymal giant cell astrocytoma -1.636 1.5e-02
Breast cancer -1.100 4.8e-09

Synonym

Accession Q86V97 Q5T6Y8 Q8N8L0 Q8NDM5 Q96MP6
Symbols

Gene

PDB

4XC2  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
25684205 KBTBD6 and KBTBD7 specifically bind to GABARAP proteins.KBTBD6 and KBTBD7 form a heterodimeric CRL3 complex.

AA Sequence

MQSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVV      1 - 70
TPGSGPGTGRLFPCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSEAN     71 - 140
VERLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFADAFGHRKLRSQAQSYIAQNFKQLSHMGSIR    141 - 210
EETLADLTLAQLLAVLRLDSLDVESEQTVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEG    211 - 280
LLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSSSNSLVSAAENPPQRLGMCAKEMVIFFG    281 - 350
HPRDPFLCCDPYSGDLYKVPSPLTCLAHTRTVTTLAVCISPDHDIYLAAQPRTDLWVYKPAQNSWQQLAD    351 - 420
RLLCREGMDVAYLNGYIYILGGRDPITGVKLKEVECYNVKRNQWALVAPLPHSFLSFDLMVIRDYLYALN    421 - 490
SKRMFCYDPSHNMWLKCVSLKRNDFQEACVFNEEIYCICDIPVMKVYNPVRAEWRQMNNIPLVSETNNYR    491 - 560
IIKHGQKLLLITSRTPQWKKNRVTVYEYDIRGDQWINIGTTLGLLQFDSNFFCLSARVYPSCLEPGQSFL    561 - 630
TEEEEIPSESSTEWDLGGFSEPDSESGSSSSLSDDDFWVRVAPQ                              631 - 674
//

Text Mined References (7)

PMID Year Title
25684205 2015 CUL3-KBTBD6/KBTBD7 ubiquitin ligase cooperates with GABARAP proteins to spatially restrict TIAM1-RAC1 signaling.
20562859 2010 Network organization of the human autophagy system.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.