Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.22
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.024 1.3e-03
adult high grade glioma -1.200 1.7e-02
aldosterone-producing adenoma -1.280 9.3e-03
atypical teratoid / rhabdoid tumor -1.500 1.3e-04
Breast cancer -1.100 4.8e-09
gastric cancer 1.100 2.4e-04
glioblastoma -1.900 4.4e-05
hepatocellular carcinoma 1.600 2.6e-05
medulloblastoma, large-cell -1.300 3.0e-05
osteosarcoma -1.331 4.8e-03
pancreatic ductal adenocarcinoma liver m... -1.553 7.3e-03
sarcoidosis 1.100 5.2e-03
subependymal giant cell astrocytoma -1.536 2.0e-02
tuberculosis -1.100 7.2e-03

Gene RIF (1)

AA Sequence

MQSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVV      1 - 70
TPGSGPGTGRLFPCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSEAN     71 - 140
VERLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFADAFGHRKLRSQAQSYIAQNFKQLSHMGSIR    141 - 210
EETLADLTLAQLLAVLRLDSLDVESEQTVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEG    211 - 280
LLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSSSNSLVSAAENPPQRLGMCAKEMVIFFG    281 - 350
HPRDPFLCCDPYSGDLYKVPSPLTCLAHTRTVTTLAVCISPDHDIYLAAQPRTDLWVYKPAQNSWQQLAD    351 - 420
RLLCREGMDVAYLNGYIYILGGRDPITGVKLKEVECYNVKRNQWALVAPLPHSFLSFDLMVIRDYLYALN    421 - 490
SKRMFCYDPSHNMWLKCVSLKRNDFQEACVFNEEIYCICDIPVMKVYNPVRAEWRQMNNIPLVSETNNYR    491 - 560
IIKHGQKLLLITSRTPQWKKNRVTVYEYDIRGDQWINIGTTLGLLQFDSNFFCLSARVYPSCLEPGQSFL    561 - 630
TEEEEIPSESSTEWDLGGFSEPDSESGSSSSLSDDDFWVRVAPQ                              631 - 674
//

Text Mined References (7)

PMID Year Title