Property Summary

NCBI Gene PubMed Count 6
PubMed Score 42.17
PubTator Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
urothelial carcinoma -1.400 3.2e-02
malignant mesothelioma 2.400 1.4e-07
glioblastoma -2.400 1.1e-04
osteosarcoma -4.295 1.6e-06
group 3 medulloblastoma -1.600 4.5e-04
cystic fibrosis 1.124 3.3e-04
atypical teratoid / rhabdoid tumor -3.000 4.2e-07
medulloblastoma, large-cell -2.200 1.8e-07
primitive neuroectodermal tumor -2.000 9.8e-04
intraductal papillary-mucinous neoplasm ... 1.100 4.5e-03
breast carcinoma -1.900 8.2e-07
fibroadenoma -1.200 2.4e-02
interstitial cystitis -1.200 1.6e-03
pediatric high grade glioma -2.300 3.4e-06
pilocytic astrocytoma -1.500 2.5e-05
subependymal giant cell astrocytoma -3.495 1.3e-02
lung adenocarcinoma -1.700 6.8e-09
ulcerative colitis -1.400 5.0e-04
ovarian cancer -1.900 2.2e-07
ileal Crohn's disease -1.102 4.3e-02

Synonym

Accession O94819 Q3L1I0
Symbols KLHDC7C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MEHAVAPCVLYPGTEPGAAGESESEGAASPAQTPCSLGASLCFSSGEESPPQSLASAAEGAATSPPSSGG      1 - 70
PRVVERQWEAGSAGAASPEELASPEERACPEEPAAPSPEPRVWLEDPASPEEPGEPAPVPPGFGAVYGEP     71 - 140
DLVLEVSGRRLRAHKAVLAARSDYFRARASRDVLRVQGVSLTALRLLLADAYSGRMAGVRPDNVAEVVAG    141 - 210
ARRLQLPGAAQRATDAVGPQLSLANCYEVLSAAKRQRLNELRDAAYCFMSDHYLEVLREPAVFGRLSGAE    211 - 280
RDLLLRRRLRAGRAHLLAAALGPAGERAGSRPQSPSGDADARGDAAVYCFHAAAGEWRELTRLPEGAPAR    281 - 350
GCGLCVLYNYLFVAGGVAPAGPDGRARPSDQVFCYNPATDSWSAVRPLRQARSQLRLLALDGHLYAVGGE    351 - 420
CLLSVERYDPRADRWAPVAPLPRGAFAVAHEATTCHGEIYVSGGSLFYRLLKYDPRRDEWQECPCSSSRE    421 - 490
RSADMVALDGFIYRFDLSGSRGEAQAAGPSGVSVSRYHCLAKQWSPCVAPLRLPGGPTGLQPFRCAALDG    491 - 560
AIYCVSRAGTWRFQPAREGEAGGDAGQGGGFEALGAPLDVRGVLIPFALSLPEKPPRGEQGAP           561 - 623
//

Text Mined References (8)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
14508709 2003 Slowed conduction and thin myelination of peripheral nerves associated with mutant rho Guanine-nucleotide exchange factor 10.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9314494 1997 High-resolution mapping and transcript identification at the progressive epilepsy with mental retardation locus on chromosome 8p.