Property Summary

NCBI Gene PubMed Count 24
PubMed Score 12.09
PubTator Score 7.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.1e-07
ependymoma 4679 4.5e-05
psoriasis 6694 6.3e-04
group 3 medulloblastoma 4104 9.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Paraplegia 74 3.704 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.100 4.5e-05
group 3 medulloblastoma 1.800 9.2e-04
ovarian cancer -1.400 2.1e-07
psoriasis 1.200 6.3e-04

Gene RIF (8)

AA Sequence

MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEINVEAKHVKDIM      1 - 70
KTLESFKLDSTPLKAAQHDLPASEGEVWSMPVPVERRPSPGPRKRQSSQYSDPKSHGNRPSTTVRVHRSS     71 - 140
AQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETNKFDSTGYDKDLVEALERDIISQNPNVRWDD    141 - 210
IADLVEAKKLLKEAVVLPMWMPEFFKGIRRPWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTS    211 - 280
KYRGESEKLVRLLFEMARFYSPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDDPS    281 - 350
KMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVDLASIAENMEGYSGAD    351 - 420
ITNVCRDASLMAMRRRIEGLTPEEIRNLSKEEMHMPTTMEDFEMALKKVSKSVSAADIERYEKWIFEFGS    421 - 490
C//

Text Mined References (30)

PMID Year Title