Property Summary

NCBI Gene PubMed Count 47
PubMed Score 181.95
PubTator Score 272.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 6.3e-06
ovarian cancer 8491 5.9e-04
osteosarcoma 7933 1.6e-03
Disease Target Count Z-score Confidence
Koolen de Vries syndrome 15 3.59 1.8
Aicardi syndrome 15 3.015 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.600 6.3e-06
osteosarcoma -1.203 1.6e-03
ovarian cancer 1.200 5.9e-04

Gene RIF (37)

PMID Text
26960573 Along with the PHF20/MOF complex, G9a links the crosstalk between ERalpha methylation and histone acetylation that governs the epigenetic regulation of hormonal gene expression.
26091365 MOF is highly enriched in induced pluripotent stem cells (iPSCs), and MOF expression is upregulated during the reprogramming process. The ectopic expression of MOF promotes reprogramming. MOF affects Wdr5 and endogenous Oct4 expression.
26032517 EZH2 (enhancer of zeste homolog 2) was up-regulated in human oral tongue squamous cell carcinoma tissues and its level positively correlated with level of hMOF.
25873202 Data found downregulation of hMOF in gastric cancer cells and tissues. Declined hMOF expression, but not high level of HDAC4, may account for global histone H4K16ac suggesting that loss of hMOF expression may be involved in gastric cancer progression.
25483274 Results show the expression of hMOF mRNA and protein was significantly downregulated in ovarian epithelial cancer tissues, and patients with high hMOF levels showed improved survival as compared to those with low hMOF levels.
25181338 The histone acetyltransferase hMOF suppresses hepatocellular carcinoma growth by targeting the expression of SIRT6.
24953651 Mutant MOF-T392A expression abrogates DSB repair in S/G2 phase cells. MOF-T392A has delayed 53BP1 dissociation and decreased DNA association.
24898892 MOF mediates Notch signaling by manipulating Histone H4 acetylation.
24802406 MOF expression was down-regulated in failing hearts at protein and mRNA levels.
24702180 Functional interactions of MYST1 with androgen receptor and NF-KB are critical for prostate cancer progression.
24571482 hMOF was overexpressed in human non-small cell lung cancer and was a predictor of poor survival.
24452550 review of regulation and function
24452485 low expression of hMOF was strongly correlated with tumor differentiation and survival of patients with gastric cancer. While in patients with renal cell carcinoma, downregulation of hMOF was connected to ccRCC and tissues with T1 tumor status.
24126058 MOF acetylation of DBC1 inhibits binding to SirT1 and serves as a mechanism that connects DNA damage signaling to SirT1 and cell fate determination.
23863932 induction of autophagy is coupled to reduction of histone H4 lysine 16 acetylation through downregulation of the histone acetyltransferase hMOF; and this histone modification regulates the outcome of autophagy
23638218 Our results demonstrate an important role of KAT8 in cancer
23628702 The hMOF mediated S phase entry by regulating H4K16ac in the Skp2 promoter region in NSCLC cells.
22918831 new insights into the mechanism and function of MYST HAT autoacetylation.
22586264 uncover novel pathways in which SIRT1 dynamically interacts with and regulates hMOF and TIP60 through deacetylation and provide additional mechanistic insights by which SIRT1 regulates DNA damage response
22152480 RNAi-mediated silencing of MOF reduced both gene activation and tumor suppression by FOXP3, while both somatic mutations in clinical cancer samples and targeted mutation of FOXP3 in mouse prostate epithelial cells disrupted nuclear localization of MOF.
22020126 MYST protein acetyltransferase activity requires active site lysine autoacetylation.
21691301 hMOF employs a novel regulatory mechanism of acetyltransferase activities
21502975 hMOF is autoacetylated in vitro and in vivo, and SIRT1, the deacetylase for H4K16Ac, is responsible for deacetylating acetylated hMOF.
21321083 data indicate that H4K20me3 invokes gene repression by antagonizing hMOF-mediated H4K16Ac
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20479123 MOF activity was associated with general chromatin upon DNA damage and colocalized with the synaptonemal complex in male meiocytes.
20018852 Although MSL-associated MOF acetylates nucleosomal histone H4 almost exclusively on lysine 16, NSL-associated MOF exhibits a relaxed specificity and also acetylates nucleosomal histone H4 on lysines 5 and 8.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19578370 Data show that MOF acetylates TIP5, the largest subunit of NoRC, at a single lysine residue, K633, adjacent to the TIP5 RNA-binding domain, and that SIRT1 (removes the acetyl group from K633.
18058815 downregulation of hMOF protein expression was associated with lower survival rates identifying hMOF as an independent prognostic marker for clinical outcome in univariate as well as multivariate analyses
17967868 MOF is an essential factor for embryogenesis and oncogenesis
17694080 hMOF is an important component of many cellular processes and plays role the in cell malignant transformation.
17182677 Cellular acetyltransferase binds HIV-1 integrase both in vitro and in cells and acetylates three specific lysine's (K264, K266, K273) in the carboxy-terminus of integrase
16227571 A multisubunit human histone acetylase complex that contains homologs of the Drosophila MSL proteins MOF, MSL1 (hampin A), MSL2, and MSL3 was described. This complex is responsible for histone H4 lysine-16 acetylation of all cellular chromosomes.
16096645 Cellular acetyltransferase binds HIV-1 integrase both in vitro and in cells and acetylates three specific lysine's (K264, K266, K273) in the carboxy-terminus of integrase
16024812 hMOF has a role in DNA damage response during cell cycle progression.
15923642 These results suggest that hMOF influences the function of ATM.

AA Sequence

MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTW      1 - 70
HSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITR     71 - 140
NQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLC    141 - 210
EYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDV    211 - 280
EPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPE    281 - 350
KPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK    351 - 420
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK                                    421 - 458
//

Text Mined References (57)

PMID Year Title
26960573 2016 G9a-mediated methylation of ER? links the PHF20/MOF histone acetyltransferase complex to hormonal gene expression.
26091365 2015 The Histone Acetyltransferase MOF Promotes Induces Generation of Pluripotent Stem Cells.
26032517 2015 hMOF (human males absent on the first), an oncogenic protein of human oral tongue squamous cell carcinoma, targeting EZH2 (enhancer of zeste homolog 2).
25873202 2015 Expression of hMOF, but not HDAC4, is responsible for the global histone H4K16 acetylation in gastric carcinoma.
25483274 2015 Expression of hMOF in different ovarian tissues and its effects on ovarian cancer prognosis.
25181338 2014 The histone acetyltransferase hMOF suppresses hepatocellular carcinoma growth.
24953651 2014 MOF phosphorylation by ATM regulates 53BP1-mediated double-strand break repair pathway choice.
24898892 2014 MDM2-MOF-H4K16ac axis contributes to tumorigenesis induced by Notch.
24802406 2014 The histone acetyltransferase MOF overexpression blunts cardiac hypertrophy by targeting ROS in mice.
24702180 2014 Coactivator MYST1 regulates nuclear factor-?B and androgen receptor functions during proliferation of prostate cancer cells.
24571482 2014 The histone acetylranseferase hMOF acetylates Nrf2 and regulates anti-drug responses in human non-small cell lung cancer.
24452550 2014 Regulation and function of histone acetyltransferase MOF.
24452485 2014 Correlation of low expression of hMOF with clinicopathological features of colorectal carcinoma, gastric cancer and renal cell carcinoma.
24126058 2013 hMOF acetylation of DBC1/CCAR2 prevents binding and inhibition of SirT1.
23863932 2013 The histone H4 lysine 16 acetyltransferase hMOF regulates the outcome of autophagy.
23638218 2013 RNAi screening identifies KAT8 as a key molecule important for cancer cell survival.
23628702 2013 Histone acetyltransferase hMOF promotes S phase entry and tumorigenesis in lung cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22918831 2012 Autoacetylation of the MYST lysine acetyltransferase MOF protein.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22586264 2012 SIRT1 negatively regulates the activities, functions, and protein levels of hMOF and TIP60.
22547026 2012 Structural insight into the regulation of MOF in the male-specific lethal complex and the non-specific lethal complex.
22152480 2011 FOXP3 orchestrates H4K16 acetylation and H3K4 trimethylation for activation of multiple genes by recruiting MOF and causing displacement of PLU-1.
22020126 2012 MYST protein acetyltransferase activity requires active site lysine autoacetylation.
21691301 2011 Regulation of the histone acetyltransferase activity of hMOF via autoacetylation of Lys274.
21502975 2011 Modulations of hMOF autoacetylation by SIRT1 regulate hMOF recruitment and activities on the chromatin.
21321083 2011 SUV420H2-mediated H4K20 trimethylation enforces RNA polymerase II promoter-proximal pausing by blocking hMOF-dependent H4K16 acetylation.
21217699 2011 Structural basis for MOF and MSL3 recruitment into the dosage compensation complex by MSL1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20620954 2010 The nonspecific lethal complex is a transcriptional regulator in Drosophila.
20479123 2010 MOF and histone H4 acetylation at lysine 16 are critical for DNA damage response and double-strand break repair.
20018852 2010 Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19578370 2009 Reversible acetylation of the chromatin remodelling complex NoRC is required for non-coding RNA-dependent silencing.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18058815 2008 The histone acetyltransferase hMOF is frequently downregulated in primary breast carcinoma and medulloblastoma and constitutes a biomarker for clinical outcome in medulloblastoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17967868 2008 The mammalian ortholog of Drosophila MOF that acetylates histone H4 lysine 16 is essential for embryogenesis and oncogenesis.
17694080 2007 Males absent on the first (MOF): from flies to humans.
16601686 2006 Tip60 and p400 are both required for UV-induced apoptosis but play antagonistic roles in cell cycle progression.
16543150 2006 Nuclear pore components are involved in the transcriptional regulation of dosage compensation in Drosophila.
16227571 2005 A human protein complex homologous to the Drosophila MSL complex is responsible for the majority of histone H4 acetylation at lysine 16.
16024812 2005 hMOF histone acetyltransferase is required for histone H4 lysine 16 acetylation in mammalian cells.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15923642 2005 Involvement of human MOF in ATM function.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397079 2002 MRG15, a novel chromodomain protein, is present in two distinct multiprotein complexes involved in transcriptional activation.
11965546 2002 MOZ and MORF histone acetyltransferases interact with the Runt-domain transcription factor Runx2.
11742995 2001 Activation of AML1-mediated transcription by MOZ and inhibition by the MOZ-CBP fusion protein.
10786633 2000 A new human member of the MYST family of histone acetyl transferases with high sequence similarity to Drosophila MOF.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.