Property Summary

Ligand Count 45
NCBI Gene PubMed Count 66
PubMed Score 282.49
PubTator Score 139.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia 1.700 2.7e-02
astrocytoma 1.400 1.8e-03
dermatomyositis 1.400 7.2e-04
diabetes mellitus -1.500 2.2e-03
lung cancer 1.100 2.9e-03
medulloblastoma, large-cell 1.200 1.3e-04
mucosa-associated lymphoid tissue lympho... -1.009 6.1e-03
Multiple myeloma 1.226 8.5e-04
ovarian cancer -1.100 5.8e-03
psoriasis 1.400 7.2e-05
sonic hedgehog group medulloblastoma 1.100 1.8e-06
Subcutaneous panniculitis-like T-cell ly... 1.600 2.9e-02
Waldenstrons macroglobulinemia 1.001 1.9e-02

Synonym

Accession Q15046 A8MSK1 D3DUK4 O14946 Q96J25 Q9HB23
Symbols KRS
KARS1
KARS2
CMTRIB
DFNB89

Gene

Protein-protein Interaction (13)

Gene RIF (59)

AA Sequence

MAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTTDNGVGPEEES      1 - 70
VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGG     71 - 140
KLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCL    141 - 210
HMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVA    211 - 280
KPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDL    281 - 350
MEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETR    351 - 420
KILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFV    421 - 490
MKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTD    491 - 560
SNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV                                     561 - 597
//

Text Mined References (80)

PMID Year Title