Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.56
PubTator Score 6.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
psoriasis -1.200 9.2e-07
glioblastoma 1.500 2.0e-02
osteosarcoma 1.570 3.9e-06
astrocytoma 2.000 1.1e-02
atypical teratoid / rhabdoid tumor -1.200 2.1e-04
medulloblastoma, large-cell -1.300 2.2e-05
Duchenne muscular dystrophy 1.319 1.2e-10
limb girdle muscular dystrophy 2A 1.013 2.5e-07
non-small cell lung cancer -1.710 3.1e-18
intraductal papillary-mucinous carcinoma... -1.300 6.8e-03
lung cancer -1.800 1.8e-05
colon cancer -2.200 5.7e-06
breast carcinoma -1.400 4.3e-05
adult high grade glioma -1.500 2.4e-04
group 4 medulloblastoma -1.200 2.5e-02
pilocytic astrocytoma 1.100 2.7e-03
non primary Sjogren syndrome sicca 1.200 1.7e-02
subependymal giant cell astrocytoma 2.709 1.3e-03
lung adenocarcinoma -1.700 3.7e-12
lung carcinoma -1.100 3.7e-11
Alzheimer's disease 1.100 1.9e-02
Pick disease 1.200 8.3e-03
ductal carcinoma in situ -1.100 7.9e-03
invasive ductal carcinoma -1.800 1.8e-03
ovarian cancer -2.200 2.4e-09
head and neck cancer -1.300 2.5e-02

Gene RIF (3)

PMID Text
25961457 identified recessive mutations in kidney ankyrin repeat-containing protein 1 (KANK1), KANK2, and KANK4 in individuals with nephrotic syndrome.
24671081 Using whole-exome sequencing, authors identified a homozygous missense c.2009C>T mutation in KANK2
17476305 SIP, a novel ankyrin repeat containing protein, sequesters steroid receptor coactivators in the cytoplasm.

AA Sequence

MAQVLHVPAPFPGTPGPASPPAFPAKDPDPPYSVETPYGYRLDLDFLKYVDDIEKGHTLRRVAVQRRPRL      1 - 70
SSLPRGPGSWWTSTESLCSNASGDSRHSAYSYCGRGFYPQYGALETRGGFNPRVERTLLDARRRLEDQAA     71 - 140
TPTGLGSLTPSAAGSTASLVGVGLPPPTPRSSGLSTPVPPSAGHLAHVREQMAGALRKLRQLEEQVKLIP    141 - 210
VLQVKLSVLQEEKRQLTVQLKSQKFLGHPTAGRGRSELCLDLPDPPEDPVALETRSVGTWVRERDLGMPD    211 - 280
GEAALAAKVAVLETQLKKALQELQAAQARQADPQPQAWPPPDSPVRVDTVRVVEGPREVEVVASTAAGAP    281 - 350
AQRAQSLEPYGTGLRALAMPGRPESPPVFRSQEVVETMCPVPAAATSNVHMVKKISITERSCDGAAGLPE    351 - 420
VPAESSSSPPGSEVASLTQPEKSTGRVPTQEPTHREPTRQAASQESEEAGGTGGPPAGVRSIMKRKEEVA    421 - 490
DPTAHRRSLQFVGVNGGYESSSEDSSTAENISDNDSTENEAPEPRERVPSVAEAPQLRPAGTAAAKTSRQ    491 - 560
ECQLSRESQHIPTAEGASGSNTEEEIRMELSPDLISACLALEKYLDNPNALTERELKVAYTTVLQEWLRL    561 - 630
ACRSDAHPELVRRHLVTFRAMSARLLDYVVNIADSNGNTALHYSVSHANFPVVQQLLDSGVCKVDKQNRA    631 - 700
GYSPIMLTALATLKTQDDIETVLQLFRLGNINAKASQAGQTALMLAVSHGRVDVVKALLACEADVNVQDD    701 - 770
DGSTALMCACEHGHKEIAGLLLAVPSCDISLTDRDGSTALMVALDAGQSEIASMLYSRMNIKCSFAPMSD    771 - 840
DESPTSSSAEE                                                               841 - 851
//

Text Mined References (28)

PMID Year Title
27161844 2016 Steroid receptor co-activator interacting protein (SIP) mediates EGF-stimulated expression of the prostaglandin synthase COX2 and prostaglandin release in human myometrium.
26739330 2016 Association of liprin ?-1 with kank proteins in melanoma.
25961457 2015 KANK deficiency leads to podocyte dysfunction and nephrotic syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
24671081 2014 Mutation in KANK2, encoding a sequestering protein for steroid receptor coactivators, causes keratoderma and woolly hair.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22371500 2012 Steroid receptor coactivator-interacting protein (SIP) inhibits caspase-independent apoptosis by preventing apoptosis-inducing factor (AIF) from being released from mitochondria.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20720434 2011 Expression of novel podocyte-associated proteins sult1b1 and ankrd25.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19554261 2009 Kank proteins: structure, functions and diseases.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17996375 2008 Kank proteins: a new family of ankyrin-repeat domain-containing proteins.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17476305 2007 SIP, a novel ankyrin repeat containing protein, sequesters steroid receptor coactivators in the cytoplasm.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.