Property Summary

NCBI Gene PubMed Count 44
PubMed Score 0.00
PubTator Score 8.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (41)

PMID Text
26896692 suggest that IFN-lambda4 protein expression associated with the IL28B-T/T variant preactivates the Janus kinase-Stat signaling
26741362 The described is the association with spontaneous hepatitis C viral clearance and genetic differentiation of IL28B/IFNL4 haplotypes in populations from Mexico.
26684959 this report shows that NF-kappa B, IRF3, IRF7, and the GC-rich DNA-binding transcription factor, Sp1, have key roles in stimulating transcription from the IFNL4 promoter.
26606750 data on ex vivo derived liver tissue samples argue against an attenuating impact of IFNL3 rs4803217 or IFNL4 rs368234815 minor alleles on hepatic IFNL3 gene expression in vivo.
26431156 IFNL4-DeltaG/TT genotype was not associated with HSV-related outcomes, including episodes of oral or genital herpes
26406534 Single-nucleotide polymorphisms (SNPs) in the interferon lambda 4 (IFNL4) gene are predictors for treatment success in patients with hepatitis C virus (HCV) infection
26372394 The hepatitis C protective allele TT was associated with decreased likelihood of HIV-1 infection in male intravenous drug users [odds ratio (OR): 0.3; P = 0.006], and this association was not modified by the genotype of CCR5.
26308395 Despite differences in protein sequences, functional properties of the recombinant human and nonhuman IFN-l4 proteins are comparable-they are all biologically active for induction of interferon signaling.
26225703 Single Nucleotide Polymorphism of Interferon Lambda-4 Gene is not Associated with Treatment Response to Pegylated Interferon in Chronic Hepatitis B.
26194286 Studies indicate that the type III interferons (IFNs) or IFN-lambdas consists of four members: IFN-lambda1 (IL-29), IFN-lambda2 (IL28A), IFN-lambda3 (IL-28B) and IFN-lambda4.
More...

AA Sequence

MRPSVWAAVAAGLWVLCTVIAAAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDP      1 - 70
PRPSSCARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKR     71 - 140
RHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCL                                   141 - 179
//

Text Mined References (45)

PMID Year Title
26896692 2016 Cellular Mechanism for Impaired Hepatitis C Virus Clearance by Interferon Associated with IFNL3 Gene Polymorphisms Relates to Intrahepatic Interferon-? Expression.
26741362 2016 Association with Spontaneous Hepatitis C Viral Clearance and Genetic Differentiation of IL28B/IFNL4 Haplotypes in Populations from Mexico.
26684959 Roles for Transcription Factors Sp1, NF-?B, IRF3, and IRF7 in Expression of the Human IFNL4 Gene.
26606750 2015 Hepatic Interferon-?3 (IFNL3) Gene Expression Reveals Not to Be Attenuated in Non-Favorable IFNL3 rs4803217 or IFNL4 rs368234815 Minor Allele Carriers in Chronic Hepatitis C.
26431156 2015 Interferon Lambda 4 Genotype Is Not Associated with Recurrence of Oral or Genital Herpes.
26406534 2016 Interferon lambda 4 genotypes and resistance-associated variants in patients infected with hepatitis C virus genotypes 1 and 3.
26372394 2015 IFNL4 rs368234815 polymorphism is associated with innate resistance to HIV-1 infection.
26308395 2016 Comparative Functional Analysis of 12 Mammalian IFN-?4 Orthologs.
26225703 2015 Single Nucleotide Polymorphism of Interferon Lambda-4 Gene is not Associated with Treatment Response to Pegylated Interferon in Thai Patients with Chronic Hepatitis B.
26194286 2015 Guarding the frontiers: the biology of type III interferons.
More...