Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 2.100 3.0e-03
fibroadenoma 2.200 4.3e-02
interstitial cystitis -1.200 5.4e-03
invasive ductal carcinoma 1.300 1.1e-03
lung adenocarcinoma 1.800 8.8e-04
nasopharyngeal carcinoma -1.200 2.3e-08
ovarian cancer 1.900 9.3e-10

AA Sequence

MAVSTEELEATVQEVLGRLKSHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCCSSPGPRRESPRK      1 - 70
VSPWKVSPAGLWDLHGTVLGVEAEGEGSGGKGAHPPREQRANLLGPAVLLVQERPKGVDNLALEP          71 - 135
//

Text Mined References (3)

PMID Year Title