Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 9.32082808567413E-10
nasopharyngeal carcinoma 1056 2.27953117383123E-8
interstitial cystitis 2299 1.19383888878816E-4
lung adenocarcinoma 2714 8.78753697174076E-4
invasive ductal carcinoma 2950 0.00110094105907454
breast carcinoma 1614 0.00299432424957538
fibroadenoma 557 0.0428521863781658

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 2.100 0.003
fibroadenoma 2.200 0.043
interstitial cystitis -1.900 0.000
lung adenocarcinoma 1.800 0.001
nasopharyngeal carcinoma -1.200 0.000
invasive ductal carcinoma 1.300 0.001
ovarian cancer 1.900 0.000

AA Sequence

MAVSTEELEATVQEVLGRLKSHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCCSSPGPRRESPRK      1 - 70
VSPWKVSPAGLWDLHGTVLGVEAEGEGSGGKGAHPPREQRANLLGPAVLLVQERPKGVDNLALEP          71 - 135
//

Text Mined References (3)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.