Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession K7EIQ3
Symbols C19orf82

 Compartment GO Term (0)

AA Sequence

MGRIPGGCSSKAFIGRAQWLTPVIPALWEAKGLTLLSRLECSDVIMDHCSPQLTGLRMKGFLAQTPPLEF      1 - 70
PVHQYQPGDHVLIKSWKRESLNQLRRTSSGTLDE                                         71 - 104
//

Text Mined References (4)

PMID Year Title