Property Summary

NCBI Gene PubMed Count 144
PubMed Score 96.60
PubTator Score 89.39

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (11)

Gene RIF (67)

PMID Text
26545977 Idiopathic pulmonary fibrosis lung fibroblasts expressed less Pkgb protein than control fibroblasts, but characteristic fibroblast phenotypes (adhesion, proliferation, and apoptosis) were not controlled by Pkgb expression.
25925948 Expression of gamma-catenin in NSCLC cells resulted in reduced cell migration as determined by both scratch assays and trans-well cell migration assays.
25549959 Immunostaining for plakoglobin might serve as an additional diagnostic marker of arrhythmogenic right ventricular cardiomyopathy in forensic pathology.
25087486 Six variants of uncertain clinical significance in the PKP2, JUP, and DSG2 genes showed a deleterious effect on mRNA splicing, indicating these are ARVD/C-related pathogenic splice site mutations.
24914344 gamma-catenin is a tumor suppressor in esophageal squamous cell carcinoma and may serve as a prognostic marker
24457449 The combination of gamma-catenin and Twist positive staining is associated with poor prognosis in malignant pleural mesothelioma.
24441103 extranuclear plakoglobin has a role in controlling cell adhesion via p38MAPK-dependent regulation of keratin filament organization
24294380 Immunohistochemical analysis of plakoglobin had a relatively high sensitivity and specificity in arrhythmogenic right ventricular cardiomyopathy, but could not be relied upon as a diagnostic test for ARVC.
24260116 Plakoglobin represses SATB1 expression and decreases in vitro proliferation, migration and invasion.
23806441 redistribution of JUP from the cell membrane to the nucleus not only has the potential to serve as a diagnostic marker for ARVC but also might provide insights into its pathogenesis
23690540 data indicate that the AhR may contribute to negative regulation of Jup gene expression in rodent cellular models, which may affect cell adherence and proliferation
23688911 Reduced immunoreactive signal of JUP at the intercalated disks can be observed in a majority of ARVD-C patients.
23687381 this data suggest that plakoglobin regulates gene expression in conjunction with p53 and that plakoglobin may regulate p53 transcriptional activity, which may account, in part, for the tumor/metastasis suppressor activity of plakoglobin.
23583905 analysis of the interaction between plakoglobin and CPI-17, which is affected by the phosphorylation status of CPI-17 in human lung microvascular endothelial cells
23555187 Gamma-catenin compensates for beta-catenin loss at adherens junctions without affecting desmosomes but is unable to fulfill functions in Wnt signaling.
23326490 CD133 interacts with plakoglobin and knockdown of CD133 by RNA interference (RNAi) results in the downregulation of desmoglein-2.
23233089 Downregulation of catenin gamma by siRNA inhibited the proliferation and colony formation of chronic myeloid leukemia cells.
23178689 A reduced immunoreactive signal of PKG, Cx43, and NaV1.5 at the intercalated disks can be observed in a large majority of the patients.
23110151 Data indicate that plakoglobin and isoforms were present in atherosclerotic plaques and their secretomes.
22860065 PG may inhibit Src by keeping VN low. Our results suggest that loss of intercellular adhesion due to reduced PG expression might be exacerbated by activation of Src through a PG-dependent mechanism
22858986 Overexpression of gamma-catenin is associated with stabilization and nuclear localization of beta-catenin resulting in acute myeloid leukemia.
22521077 Gastroesophageal reflux disease was specifically associated with elevated transcript levels of desmoglein 2 and plakoglobin
22496452 This study thus implicates SLUG-induced repression of plakoglobin as a motility determinant in highly disseminating breast cancer.
22454524 Rnd3 regulates desmosome function and keratinocyte cell death via a plakoglobin-dependent mechanism.
22315228 Lack of plakoglobin in epidermis leads to keratoderma.
22276604 Induced gene expression levels of plakoglobin, desmoglein-1 and desmoglein-2 correlated significantly with dilatation of intercellular spaces and basal cell hyperplasia in esophageal mucosa of patients with gastro-oesophageal reflux disease.
22098624 The junction plakoglobin (JUP) interacts with SOX4 in both the cytosol and the nucleus and the interaction between SOX4 and plakoglobin is significantly increased when prostate and breast cancer cells are stimulated with WNT3A.
22098624 Junction plakoglobin (JUP) interacts with SOX4 in both the cytosol and the nucleus and the interaction between SOX4 and plakoglobin is significantly increased when prostate and breast cancer cells are stimulated with WNT3A.
22046445 the junctional protein plakoglobin is a key regulator of cell-cell contact,which may be a fundamental control mechanism governing cell viability
21859801 Disease mechanisms, involving desmosomal proteins (such as plakoglobin) in granulomatous myocarditis, and implicating cytokines, are involved in the disruption of desmosomal proteins and arrhythmogenesis in arrhythmogenic right ventricular cardiomyopathy.
21781455 The presence of beta and gamma catenin, particularly in osteoblasts, demonstrates a significant role of catenins in functions such as signaling and activation of transcription factors during differentiation of bone tissues
21158719 investigation of role of gamma catenin and CBP (CREB-Binding Protein) in regulation of transcription of survivin
21075858 Plakoglobin rescues adhesive defects induced by ectodomain truncation of the desmosomal cadherin desmoglein 1.
21059263 sonic hedgehog-GLI1 downstream target genes PTCH1, Cyclin D2, Plakoglobin, PAX6 and NKX2.2 are differently regulated in medulloblastoma and astrocytoma
20933443 Data show that E-cadherin and alpha-catenin were predominantly expressed in the cell membranes, whereas beta- and gamma-catenin were found both in the cell membrane and cytoplasm.
20864495 Studies identified two mutations in DSG2, four in DSC2, two in DSP, four in JUP and seven in PKP2.
20859650 plakoglobin and E-cadherin recruit plakophilin3 to the cell border to initiate desmosome formation
20737155 The correlation of upregulated cellular gamma-catenin levels with higher recurrences and impaired survival suggests a tumor promoting role of gamma-catenin in colorectal cancer.
20529828 The study objective was to assess changes in the expressions of E-cadherin and alpha-, beta- and gamma-catenin proteins in pancreatic duct carcinoma in correlation with clinicopathological parameters, lymph node involvement and distant metastases.
20529814 The E-cadherin-catenin complex is the factor indicative of metastasis and disease progression in gastric cancer.
20525856 Observational study of gene-disease association. (HuGE Navigator)
20400443 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20130592 Plakoglobin (PG) is required for correct maintenance of skin integrity, and the absence of heart phenotype in patients suggests that aberrant PG expression does not compromise normal human heart development in children.
20101217 Plakoglobin has a role in regulating the metastasis suppressor activity of Nm23.
20031617 Observational study of gene-disease association. (HuGE Navigator)
19584275 Data show that increased association of junctional plakoglobin with N-cadherin was a distinguishing feature of LMP1-expressing cells.
19348003 Both the binding of desmocollin 3 (Dsc3) to plakoglobin and Dsc3 phosphorylation are involved in Dsc3 binding to desmoglein 3 (Dsg3) during Ca2+ -induced desmosome assembly.
18937352 different mutations in plakoglobin have markedly disparate effects on cell mechanical behavior, suggesting complex biomechanical roles for this protein.
18837082 Reduced expression of E-cadherin/catenin complex in hepatocellular carcinomas.
18568994 In Wilm's tumors,there was an absence of strong correlation between the loss of gamma-catenin and unfavorable outcome.
18469796 Abnormal plakoglobin expression may be involved in the formation of some cases of Paget's of the vulva and the breast.
18245958 Overexpression of gamma-catenin caused an increase in PTTG and c-Myc protein levels, which are likely to accelerate chromosomal instability and uncontrolled proliferation, respectively, in the affected cells.
17998942 the autocrine hGH-stimulated increases in DNMT3A and DNMT3B expression mediate repression of plakoglobin gene transcription by direct hypermethylation of its promoter and consequent phenotypic conversion of mammary carcinoma cells
17924338 A dominant mutation in the gene encoding plakoglobin in a German family with Arrhythmogenic right ventricular cardiomyopathy but no cutaneous abnormalities, is reported.
16537559 plakoglobin is differentially expressed in alveolar and embryonal rhabdomyosarcoma and its expression depends on the methylation and acetylation status of the gene
15942628 results show that plakoglobin acts as a tumour suppressor gene in bladder carcinoma cells and the silencing of plakoglobin gene expression in late-stage bladder cancer is a primary event in tumour progression
15916880 Loss of expression indicated a reduced survival rate in nodal-negative squamous cell carcinomas of the mouth floor
15781623 The gamma-catenin mutation related to Bcl-2 overexpression has a significant effect on the pathogenesis of hormone refractory prostate cancer.
15701841 Methylation of the gamma-catenin gene is associated with renal cell carcinoma
14739224 show that the AML-associated translocation products (AATPs) directly activate the gamma-catenin promoter, which plays a crucial role in increasing the self-renewal of HSCs upon expression of AATPs
14661058 plakoglobin is a new target gene governed by HDAC, and it acts as an oncogene in HT1080 cells
14661054 plakoglobin can activate the Wnt signaling cascade directly without interaction of beta-catenin, and that plakoglobin has multiple functions as a transcriptional activator and a cell adhesion molecule like beta-catenin
14517306 phosphorylation of Tyr549 and the increased binding of plakoglobin to components of adherens junctions can contribute to the upregulation of the transcriptional activity of the beta-catenin-Tcf-4 complex observed in many epithelial tumor cells
12939402 heregulin/neuregulin-1 induces binding of MUC1 and gamma-catenin and targeting of the MUC1-gamma-catenin complex to the nucleolus
12386812 function as an inhibitor of beta-catenin/TCF-dependent gene transcription and role as a potentially novel tumor suppressor protein in a subset of human NSCLC cancers
12068170 stimulation of beta-catenin and suppression of gamma-catenin expression, occur within endometrial carcinomas with squamous differentiation
11984022 Arrhythmogenic right ventricular cardiomyopathy caused by a deletion in plakoglobin (Naxos disease). Review.

AA Sequence

MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQG      1 - 70
DLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELA     71 - 140
TRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILH    141 - 210
NLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKN    211 - 280
NPKFLAITTDCLQLLAYGNQESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVE    281 - 350
AGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC    351 - 420
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLN    421 - 490
QPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIV    491 - 560
EGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPL    561 - 630
MELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDMDAT    631 - 700
YRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA                             701 - 745
//

Text Mined References (155)

PMID Year Title
26545977 2015 Plakoglobin expression in fibroblasts and its role in idiopathic pulmonary fibrosis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25925948 2015 Novel Role for ?-Catenin in the Regulation of Cancer Cell Migration via the Induction of Hepatocyte Growth Factor Activator Inhibitor Type 1 (HAI-1).
25549959 2015 Plakoglobin: a diagnostic marker of arrhythmogenic right ventricular cardiomyopathy in forensic pathology?
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25225338 2014 Disease mutations in desmoplakin inhibit Cx43 membrane targeting mediated by desmoplakin-EB1 interactions.
25087486 2014 Functional assessment of potential splice site variants in arrhythmogenic right ventricular dysplasia/cardiomyopathy.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24914344 2014 Down-regulated ?-catenin expression is associated with tumor aggressiveness in esophageal cancer.
24457449 2014 Clinical significance of epithelial-mesenchymal transition-associated markers in malignant pleural mesothelioma.
24441103 2014 Plakoglobin but not desmoplakin regulates keratinocyte cohesion via modulation of p38MAPK signaling.
24294380 2013 Clinical usefulness of immunohistochemistry for plakoglobin, N-cadherin, and connexin-43 in the diagnosis of arrhythmogenic right ventricular cardiomyopathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260116 2013 Plakoglobin represses SATB1 expression and decreases in vitro proliferation, migration and invasion.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23806441 On the diagnostic utility of junction plakoglobin in arrhythmogenic right ventricular cardiomyopathy.
23690540 2013 Aryl hydrocarbon receptor negatively regulates expression of the plakoglobin gene (jup).
23688911 Reduced plakoglobin immunoreactivity in arrhythmogenic cardiomyopathy: methodological considerations.
23687381 2013 Plakoglobin interacts with the transcription factor p53 and regulates the expression of 14-3-3?.
23583905 2013 Putative protein partners for the human CPI-17 protein revealed by bacterial two-hybrid screening.
23555187 2013 ?-Catenin at adherens junctions: mechanism and biologic implications in hepatocellular cancer after ?-catenin knockdown.
23381804 2013 Mutated desmoglein-2 proteins are incorporated into desmosomes and exhibit dominant-negative effects in arrhythmogenic right ventricular cardiomyopathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23326490 2013 The cancer stem cell marker CD133 interacts with plakoglobin and controls desmoglein-2 protein levels.
23233089 2013 Downregulation of ?-catenin inhibits CML cell growth and potentiates the response of CML cells to imatinib through ?-catenin inhibition.
23178689 2013 Remodeling of the cardiac sodium channel, connexin43, and plakoglobin at the intercalated disk in patients with arrhythmogenic cardiomyopathy.
23136403 2013 Mutations in the area composita protein ?T-catenin are associated with arrhythmogenic right ventricular cardiomyopathy.
23110151 2012 Antibody phage display assisted identification of junction plakoglobin as a potential biomarker for atherosclerosis.
22889254 2013 Detection of genomic deletions of PKP2 in arrhythmogenic right ventricular cardiomyopathy.
22860065 2012 The desmosomal armadillo protein plakoglobin regulates prostate cancer cell adhesion and motility through vitronectin-dependent Src signaling.
22858986 2013 ?-Catenin is overexpressed in acute myeloid leukemia and promotes the stabilization and nuclear localization of ?-catenin.
22781308 2012 Molecular insights into arrhythmogenic right ventricular cardiomyopathy caused by plakophilin-2 missense mutations.
22521077 2012 Assessment of desmosomal components (desmoglein 1-3, plakoglobin) in cardia mucosa in relation to gastroesophageal reflux disease and Helicobacter pylori infection.
22496452 2012 High motility of triple-negative breast cancer cells is due to repression of plakoglobin gene by metastasis modulator protein SLUG.
22454524 2012 Plakoglobin-dependent regulation of keratinocyte apoptosis by Rnd3.
22315228 2012 Lack of plakoglobin in epidermis leads to keratoderma.
22276604 2012 Gastro-oesophageal reflux disease is associated with up-regulation of desmosomal components in oesophageal mucosa.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22098624 2011 SOX4 interacts with plakoglobin in a Wnt3a-dependent manner in prostate cancer cells.
22046445 2011 Cell-cell contact preserves cell viability via plakoglobin.
21859801 2011 Altered desmosomal proteins in granulomatous myocarditis and potential pathogenic links to arrhythmogenic right ventricular cardiomyopathy.
21781455 Expression of ?-catenin and ?-catenin in maxillary bone regeneration.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21158719 2011 The gamma catenin/CBP complex maintains survivin transcription in ?-catenin deficient/depleted cancer cells.
21075858 2010 Plakoglobin rescues adhesive defects induced by ectodomain truncation of the desmosomal cadherin desmoglein 1: implications for exfoliative toxin-mediated skin blistering.
21062920 2011 Mechanistic insights into arrhythmogenic right ventricular cardiomyopathy caused by desmocollin-2 mutations.
21059263 2010 Regulation of sonic hedgehog-GLI1 downstream target genes PTCH1, Cyclin D2, Plakoglobin, PAX6 and NKX2.2 and their epigenetic status in medulloblastoma and astrocytoma.
20936779 2010 A human MAP kinase interactome.
20933443 2012 Altered expression of cell adhesion molecules leads to differential uptake of hypericin in urothelial cancer.
20864495 2010 Wide spectrum of desmosomal mutations in Danish patients with arrhythmogenic right ventricular cardiomyopathy.
20859650 2011 E-cadherin and plakoglobin recruit plakophilin3 to the cell border to initiate desmosome assembly.
20737155 2010 ?-Catenin is an independent prognostic marker in early stage colorectal cancer.
20529828 2010 Expression of the E-cadherin-catenin complex in patients with pancreatic ductal adenocarcinoma.
20529814 2010 The expression of E-cadherin-catenin complex in patients with advanced gastric cancer: role in formation of metastasis.
20525856 2010 Lower than expected desmosomal gene mutation prevalence in endurance athletes with complex ventricular arrhythmias of right ventricular origin.
20400443 2010 Desmosomal gene analysis in arrhythmogenic right ventricular dysplasia/cardiomyopathy: spectrum of mutations and clinical impact in practice.
20130592 2010 Homozygous mutations in the 5' region of the JUP gene result in cutaneous disease but normal heart development in children.
20101217 2010 Plakoglobin interacts with and increases the protein levels of metastasis suppressor Nm23-H2 and regulates the expression of Nm23-H1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20031617 2009 Comprehensive desmosome mutation analysis in north americans with arrhythmogenic right ventricular dysplasia/cardiomyopathy.
19863551 2010 Role of genetic testing in arrhythmogenic right ventricular cardiomyopathy/dysplasia.
19759396 2009 Interactions of plakoglobin and beta-catenin with desmosomal cadherins: basis of selective exclusion of alpha- and beta-catenin from desmosomes.
19584275 2009 Epstein-Barr virus latent membrane protein-1 effects on junctional plakoglobin and induction of a cadherin switch.
19348003 2009 Low to high Ca2+ -switch causes phosphorylation and association of desmocollin 3 with plakoglobin and desmoglein 3 in cultured keratinocytes.
19060904 2009 An empirical framework for binary interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18937352 2008 Disparate effects of different mutations in plakoglobin on cell mechanical behavior.
18837082 2008 Reduced expression of E-cadherin/catenin complex in hepatocellular carcinomas.
18568994 2008 Immunohistochemical analysis of gamma catenin in Wilms' tumors.
18469796 2008 Reduced E-cadherin expression correlates with disease progression in Paget's disease of the vulva but not Paget's disease of the breast.
18245958 2007 Aberrant activation of gamma-catenin promotes genomic instability and oncogenic effects during tumor progression.
17998942 2008 DNMT3A and DNMT3B mediate autocrine hGH repression of plakoglobin gene transcription and consequent phenotypic conversion of mammary carcinoma cells.
17924338 2007 A novel dominant mutation in plakoglobin causes arrhythmogenic right ventricular cardiomyopathy.
17559062 2008 The most widespread desmosomal cadherin, desmoglein 2, is a novel target of caspase 3-mediated apoptotic machinery.
17510365 2007 Wilms tumor suppressor WTX negatively regulates WNT/beta-catenin signaling.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17002498 2006 Adenomatous polyposis coli (APC) is required for normal development of skin and thymus.
16917092 2006 Desmosomal dysfunction due to mutations in desmoplakin causes arrhythmogenic right ventricular dysplasia/cardiomyopathy.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16537559 2006 Plakoglobin is differentially expressed in alveolar and embryonal rhabdomyosarcoma and is regulated by DNA methylation and histone acetylation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15942628 2005 Restoration of plakoglobin expression in bladder carcinoma cell lines suppresses cell migration and tumorigenic potential.
15916880 2005 Catenin expression in T1/2 carcinomas of the floor of the mouth.
15781623 2005 Functional Loss of the gamma-catenin gene through epigenetic and genetic pathways in human prostate cancer.
15701841 2005 Methylation of the gamma-catenin gene is associated with poor prognosis of renal cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14739224 2004 Gamma-catenin contributes to leukemogenesis induced by AML-associated translocation products by increasing the self-renewal of very primitive progenitor cells.
14661058 2004 Plakoglobin is a new target gene of histone deacetylase in human fibrosarcoma HT1080 cells.
14661054 2004 Plakoglobin (gamma-catenin) has TCF/LEF family-dependent transcriptional activity in beta-catenin-deficient cell line.
14517306 2003 Tyrosine phosphorylation of plakoglobin causes contrary effects on its association with desmosomes and adherens junction components and modulates beta-catenin-mediated transcription.
12939402 2003 Heregulin targets gamma-catenin to the nucleolus by a mechanism dependent on the DF3/MUC1 oncoprotein.
12847106 2003 Plakoglobin is O-glycosylated close to the N-terminal destruction box.
12808048 2003 The protein tyrosine phosphatase Pez is a major phosphatase of adherens junctions and dephosphorylates beta-catenin.
12604612 2003 N-cadherin-catenin complexes form prior to cleavage of the proregion and transport to the plasma membrane.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12386812 2002 gamma-Catenin expression is reduced or absent in a subset of human lung cancers and re-expression inhibits transformed cell growth.
12370829 2002 The transmembrane receptor protein tyrosine phosphatase DEP1 interacts with p120(ctn).
12068170 2002 Loss of gamma-Catenin expression in squamous differentiation in endometrial carcinomas.
12003790 2002 Histamine stimulates phosphorylation of adherens junction proteins and alters their link to vimentin.
11984022 2002 Arrhythmogenic right ventricular cardiomyopathy caused by a deletion in plakoglobin (Naxos disease).
11790773 2002 Protein binding and functional characterization of plakophilin 2. Evidence for its diverse roles in desmosomes and beta -catenin signaling.
11711551 2002 The transcriptional factor Tcf-4 contains different binding sites for beta-catenin and plakoglobin.
11710948 2001 Isoform-specific differences in the size of desmosomal cadherin/catenin complexes.
11707392 2001 Molecular mechanisms of beta-catenin recognition by adenomatous polyposis coli revealed by the structure of an APC-beta-catenin complex.
11348595 2001 The structure of the beta-catenin/E-cadherin complex and the molecular basis of diverse ligand recognition by beta-catenin.
11274246 2001 Polycystin: new aspects of structure, function, and regulation.
11136974 2000 Crystal structure of a beta-catenin/Tcf complex.
11016852 2000 Genomic organization and amplification of the human plakoglobin gene (JUP).
10959047 2000 The E-cadherin-catenin complex in tumour metastasis: structure, function and regulation.
10902626 2000 Identification of a deletion in plakoglobin in arrhythmogenic right ventricular cardiomyopathy with palmoplantar keratoderma and woolly hair (Naxos disease).
10868478 2000 Suppression of breast cancer invasion and migration by indole-3-carbinol: associated with up-regulation of BRCA1 and E-cadherin/catenin complexes.
10825188 2000 Differential mechanisms of LEF/TCF family-dependent transcriptional activation by beta-catenin and plakoglobin.
10803460 2000 Differential interaction of plakoglobin and beta-catenin with the ubiquitin-proteasome system.
10801826 2000 Platelet-endothelial cell adhesion molecule-1 (CD31), a scaffolding molecule for selected catenin family members whose binding is mediated by different tyrosine and serine/threonine phosphorylation.
10769211 2000 Different effects of dominant negative mutants of desmocollin and desmoglein on the cell-cell adhesion of keratinocytes.
10769205 2000 The amino- and carboxyl-terminal tails of (beta)-catenin reduce its affinity for desmoglein 2.
10488109 1999 Axin directly interacts with plakoglobin and regulates its stability.
10460003 1999 Cadherin and catenin expression in normal human bronchial epithelium and non-small cell lung cancer.
10403777 1999 Regulation of endothelial cell adherens junctions by a Ras-dependent signal transduction pathway.
9739078 1998 VE-cadherin and desmoplakin are assembled into dermal microvascular endothelial intercellular junctions: a pivotal role for plakoglobin in the recruitment of desmoplakin to intercellular junctions.
9606214 1998 Defining the interactions between intermediate filaments and desmosomes.
9443898 1998 Coexpression of both types of desmosomal cadherin and plakoglobin confers strong intercellular adhesion.
9348293 1997 The amino-terminal domain of desmoplakin binds to plakoglobin and clusters desmosomal cadherin-plakoglobin complexes.
9298899 1997 Three-dimensional structure of the armadillo repeat region of beta-catenin.
9245795 1997 Cellular redistribution of protein tyrosine phosphatases LAR and PTPsigma by inducible proteolytic processing.
9168809 1997 M-cadherin-mediated cell adhesion and complex formation with the catenins in myogenic mouse cells.
9152027 1997 Characterization of the interactions of alpha-catenin with alpha-actinin and beta-catenin/plakoglobin.
9139698 1997 Interaction of the DF3/MUC1 breast carcinoma-associated antigen and beta-catenin in cell adhesion.
9110993 1997 Identification of the domain of alpha-catenin involved in its association with beta-catenin and plakoglobin (gamma-catenin).
8749329 1995 The fourth armadillo repeat of plakoglobin (gamma-catenin) is required for its high affinity binding to the cytoplasmic domains of E-cadherin and desmosomal cadherin Dsg2, and the tumor suppressor APC protein.
8743961 1996 Plakoglobin domains that define its association with the desmosomal cadherins and the classical cadherins: identification of unique and shared domains.
8663237 1996 Association of human protein-tyrosine phosphatase kappa with members of the armadillo family.
8631907 1996 Desmosomal cadherin binding domains of plakoglobin.
8576101 1995 Cloning of an alternative form of plakoglobin (gamma-catenin) lacking the fourth armadillo repeat.
8314871 1993 Stratification-related expression of isoforms of the desmosomal cadherins in human epidermis.
8207061 1994 Dynamics of cadherin/catenin complex formation: novel protein interactions and pathways of complex assembly.
7983064 1994 Posttranslational regulation of plakoglobin expression. Influence of the desmosomal cadherins on plakoglobin metabolic stability.
7982500 1994 Distinct cadherin-catenin complexes in Ca(2+)-dependent cell-cell adhesion.
7971964 1994 Identification of amino acid sequence motifs in desmocollin, a desmosomal glycoprotein, that are required for plakoglobin binding and plaque formation.
7890674 1995 The APC protein and E-cadherin form similar but independent complexes with alpha-catenin, beta-catenin, and plakoglobin.
7876318 1995 Association of p120, a tyrosine kinase substrate, with E-cadherin/catenin complexes.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.
7738346 1995 Plakoglobin binding by human Dsg3 (pemphigus vulgaris antigen) in keratinocytes requires the cadherin-like intracytoplasmic segment.
7702605 1995 c-erbB-2 gene product directly associates with beta-catenin and plakoglobin.
7650039 1995 Identification of plakoglobin domains required for association with N-cadherin and alpha-catenin.
7604000 1995 The human plakoglobin gene localizes on chromosome 17q21 and is subjected to loss of heterozygosity in breast and ovarian cancers.
2726765 1989 Molecular cloning and amino acid sequence of human plakoglobin, the common junctional plaque protein.
1889810 1991 Chromosomal assignment of the human genes coding for the major proteins of the desmosome junction, desmoglein DGI (DSG), desmocollins DGII/III (DSC), desmoplakins DPI/II (DSP), and plakoglobin DPIII (JUP).
1639850 1992 Plakoglobin, or an 83-kD homologue distinct from beta-catenin, interacts with E-cadherin and N-cadherin.