Property Summary

NCBI Gene PubMed Count 87
PubMed Score 246.90
PubTator Score 327.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
gastric cancer -1.900 4.0e-02
Multiple myeloma 1.021 1.2e-02
ependymoma 1.400 1.2e-02
psoriasis -1.700 3.3e-05
atypical teratoid / rhabdoid tumor 1.400 5.6e-04
glioblastoma 1.500 1.7e-03
medulloblastoma 1.500 8.5e-03
medulloblastoma, large-cell 1.300 2.5e-04
pancreatic ductal adenocarcinoma liver m... 1.452 8.2e-03
non-small cell lung cancer -1.392 8.8e-12
lung cancer -1.300 8.0e-05
active Crohn's disease -1.413 2.3e-02
subependymal giant cell astrocytoma -1.321 1.3e-02
COPD -1.600 4.1e-03
Polycystic Ovary Syndrome -1.033 1.3e-02
lung carcinoma -1.100 1.4e-09
ovarian cancer 1.200 7.3e-03
Gaucher disease type 3 1.600 5.3e-03

Gene RIF (47)

PMID Text
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26305372 recombinant SERPINE2 induced a clear inhibition of MMP-13 expression in IL-1alpha-stimulated chondrocytes. This inhibitory effect is likely regulated through a pathway involving ERK 1/2, NF-kappaB and AP-1
25906693 miR-494 is a novel regulator of HNPC apoptosis induced by TNF-alpha
25788572 JunD activates miR-29b by enhancing its transcription and processing, which contribute to the inhibitory effect of JunD
24658685 Cells in contact with basement membrane undergo transient oscillations between two molecular states defined by their TGFBR3- JUND expression.
24551192 HIV-1 Vpu-expressing U937 monocytes coculture with LX2 stellate cells to activate release of transforming growth factor beta to culture supernatant, which correlates with increased activity of the AP-1 transcription factor
24140207 BAG3 stabilized JunD mRNA.
24038602 Binding of specific AP-1 factors, we found JunD associated with the LILRB1 distal promoter.
23942796 Jun proteins (pc-Jun and JunD) influence carcinogenesis and tumour progression, suggesting a significant role as prognostic predictors in human ovarian carcinoma.
23376981 This genotype-phenotype correlation study confirmed the lack of direct genotype-phenotype correlations. However, patients with mutations affecting the JunD interacting domain had a higher risk of death secondary to a MEN1 tumor
22696638 HTLV-1 bZIP factor(hbz) requires cellular JunD to upregulate HTLV-1 antisense transcription from the 3' long terminal repeat.
22493372 results demonstrate the presence of a common oncogenic cascade initiated by FRA2/JUND in CCR4-expressing mature T-cell malignancies such as ATLL and CTCLs
22327296 crystal structures of human menin in its free form and in complexes with MLL1 or with JUND, or with an MLL1-LEDGF heterodimer
21734453 Apoptosis induction by dominant negative JunD is due to induction of growth arrest and DNA damage inducible proteins (GADD) 45 alpha and 45 gamma proteins.
21559334 CDK4-mediated regulation of cell functions via c-Jun phosphorylation and AP-1 activation
21473742 data indicate that JunD is an inhibitor of RHOH gene expression.
21393445 JunD mediates, whereas c-Jun modulates, prostaglandin E2 activation of aromatase promoters
21315773 These results suggest that the induction of MMP-7 by Tax is regulated by JunD and that MMP-7 could facilitate visceral invasion in adult T-cell leukemia .
19470832 Decreased Jun-D and myogenin expression in muscle wasting of human cachexia.
19211927 Data suggest that TGF-beta1 up-regulates angiotensinogen transcription through a mechanism that requires both JunD and HIF-1alpha binding to the AGT core promoter, and that a molecular mechanism links hypoxia signaling and fibrogenic stimuli in the lung.
19166930 Activated c-Jun is dimerized with JunD in response to adrenomedullin.
18952102 These results reveal the molecular bases of the expression specificity of PADI1 and PADI3 during keratinocyte differentiation through a long-range enhancer and support a model of PADI gene regulation depending on c-Jun-JunD competition.
18562690 JunD is a biological suppressor of ZO-1 expression in intestinal epithelial cells and plays a critical role in maintaining epithelial barrier function
18454173 JunD activation reduces the proliferation of cancer cells.
18443593 JunD is a major determinant of macrophage activity and is associated with glomerulonephritis susceptibility.
18386285 JunD overexpression increases production of reactive oxygen species in LNCaP cells in a low androgen environment.
18321953 Damaging exercise induced the expression of capZalpha, MCIP1, CARP1, DNAJB2, c-myc, and junD, each of which are likely involved in skeletal muscle growth, remodeling, and stress management.
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18078517 evidence is provided that HBZ/JunD heterodimers interact with Sp1 transcription factors and that activation of hTERT transcription by these heterodimers is mediated through binding sites for Sp1 present in the hTERT promoter.
18071306 aberrantly expressed Fra-2 in association with JunD may play a major role in CCR4 expression and oncogenesis in adult t-cell leukemia.
17681951 Dimerization with the Jun proteins inhibits c-Fos nuclear exit.
17651017 Our data suggest that JUND and CLDN4 are critical mediators of the antiproliferative and antiviral effects of type I IFNs and further confirm the functional importance of the DNA-binding domain of Stat2.
17495958 Coordinated down- and up-regulation of the various AP-1 subunits in the course of epidermal wound healing is important for its undisturbed progress, putatively by influencing inflammation and cell-cell communication.
17205062 Pyk2 regulation is associated with increased expression of Fra-1 and JunD, activator protein-1 transcription factors known to be required for involucrin expression.
17204476 JunB and JunD contribute opposing effects; JunB activated whereas JunD repressed heme oxygenase-1 expression in human renal epithelial cells
16264271 Menin's dynamic regulation of histone modifiers with JunD is responsible for PKC theta-synergistic effect on Nur77 expression in T cell
16129800 JunD limits cardiomyocyte hypertrophy and protects the pressure-overloaded heart from cardiac apoptosis
16007120 JunD is another ARE regulatory protein for transcriptional activation of the human ferritin H gene and probably other antioxidant genes containing the conserved ARE sequences by which JunD may confer cytoprotection during oxidative stress
15563473 menin suppresses osteoblast maturation, in part, by inhibiting the differentiation actions of JunD
15507668 c-jun, junD, junB, and c-fos and Notch2 are expressed in splenic marginal zone lymphoma
15044019 Data show that human T-cell leukemia virus type I (HTLV-I) bZIP factor can activate JunD-dependent transcription and that its amino-terminus is required.
14559791 Menin is important for recruiting an mSin3A-histone deacetylase complex to repress JunD transcriptional activity.
12727841 Constitutive activation of nuclear factor kappaB p50/p65 and Fra-1 and JunD is essential for deregulated interleukin 6 expression in prostate cancer.
12105216 Translation initiation from alternative AUG and non-AUG sites in human, mouse and rat.
12082101 junD activation by ultraviolet rays plays a role in apoptosis in myeloblastic leukemia ML-1 cells
12054733 JunD activated by LHRH acts as a modulator of cell proliferation and cooperates with the anti-apoptotic and anti-mitogenic functions of LHRH.
11903046 An alternative model of H ferritin promoter transactivation by c-Jun

AA Sequence

METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPP      1 - 70
TPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGF     71 - 140
VKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGA    141 - 210
ATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRI    211 - 280
AASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY       281 - 347
//

Text Mined References (92)

PMID Year Title
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26305372 2015 SERPINE2 Inhibits IL-1?-Induced MMP-13 Expression in Human Chondrocytes: Involvement of ERK/NF-?B/AP-1 Pathways.
25906693 2015 MicroRNA-494 inhibition protects nucleus pulposus cells from TNF-?-induced apoptosis by targeting JunD.
25788572 2015 JunD enhances miR-29b levels transcriptionally and posttranscriptionally to inhibit proliferation of intestinal epithelial cells.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24658685 2014 A time- and matrix-dependent TGFBR3-JUND-KRT5 regulatory circuit in single breast epithelial cells and basal-like premalignancies.
24647988 2014 Targeting androgen receptor and JunD interaction for prevention of prostate cancer progression.
24140207 2013 BAG3 is upregulated by c-Jun and stabilizes JunD.
24038602 2014 The AP-1 transcription factor JunD activates the leukocyte immunoglobulin-like receptor 1 distal promoter.
24029232 2013 Protein kinase C ? is a central signaling node and therapeutic target for breast cancer stem cells.
23942796 2013 The prognostic significance of Jun transcription factors in ovarian cancer.
23784080 2013 HTLV-1 bZIP factor impedes the menin tumor suppressor and upregulates JunD-mediated transcription of the hTERT gene.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23376981 2013 Higher risk of death among MEN1 patients with mutations in the JunD interacting domain: a Groupe d'etude des Tumeurs Endocrines (GTE) cohort study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22696638 2012 Human T-cell leukemia virus type 1 (HTLV-1) bZIP factor requires cellular transcription factor JunD to upregulate HTLV-1 antisense transcription from the 3' long terminal repeat.
22493372 2012 Expression and function of FRA2/JUND in cutaneous T-cell lymphomas.
22327296 2012 The same pocket in menin binds both MLL and JUND but has opposite effects on transcription.
21734453 2011 JunD-mediated repression of GADD45? and ? regulates escape from cell death in prostate cancer.
21559334 2011 CDK-mediated regulation of cell functions via c-Jun phosphorylation and AP-1 activation.
21473742 2011 Repression of the RHOH gene by JunD.
21393445 2011 JunD and JunB integrate prostaglandin E2 activation of breast cancer-associated proximal aromatase promoters.
21315773 2011 Human T-cell leukemia virus type 1 tax transactivates the matrix metalloproteinase 7 gene via JunD/AP-1 signaling.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19470832 2009 Decreased Jun-D and myogenin expression in muscle wasting of human cachexia.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19211927 2009 JunD and HIF-1alpha mediate transcriptional activation of angiotensinogen by TGF-beta1 in human lung fibroblasts.
19166930 2009 Adrenomedullin promotes cell cycle transit and up-regulates cyclin D1 protein level in human glioblastoma cells through the activation of c-Jun/JNK/AP-1 signal transduction pathway.
18952102 2008 Long-range enhancer differentially regulated by c-Jun and JunD controls peptidylarginine deiminase-3 gene in keratinocytes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18562690 2008 JunD represses transcription and translation of the tight junction protein zona occludens-1 modulating intestinal epithelial barrier function.
18454173 2008 JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells.
18443593 2008 Jund is a determinant of macrophage activation and is associated with glomerulonephritis susceptibility.
18386285 2008 JunD mediates androgen-induced oxidative stress in androgen dependent LNCaP human prostate cancer cells.
18321953 2008 Gene expression profiling in human skeletal muscle during recovery from eccentric exercise.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
18078517 2007 HTLV-1 HBZ cooperates with JunD to enhance transcription of the human telomerase reverse transcriptase gene (hTERT).
18071306 2008 Aberrant expression of Fra-2 promotes CCR4 expression and cell proliferation in adult T-cell leukemia.
17681951 2007 Heterodimerization with Jun family members regulates c-Fos nucleocytoplasmic traffic.
17651017 2007 Interferon-inducible Stat2 activation of JUND and CLDN4: mediators of IFN responses.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17495958 2007 Biphasic regulation of AP-1 subunits during human epidermal wound healing.
17205062 2007 The role of proline-rich protein tyrosine kinase 2 in differentiation-dependent signaling in human epidermal keratinocytes.
17204476 2007 JunB and JunD regulate human heme oxygenase-1 gene expression in renal epithelial cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16423552 2006 Jun signalling in the epidermis: From developmental defects to psoriasis and skin tumors.
16264271 2005 Menin represses JunD transcriptional activity in protein kinase C theta-mediated Nur77 expression.
16129800 2005 Lack of JunD promotes pressure overload-induced apoptosis, hypertrophic growth, and angiogenesis in the heart.
16007120 2005 JunD activates transcription of the human ferritin H gene through an antioxidant response element during oxidative stress.
15563473 2005 Menin suppresses osteoblast differentiation by antagonizing the AP-1 factor, JunD.
15507668 2004 Constitutive expression of the AP-1 transcription factors c-jun, junD, junB, and c-fos and the marginal zone B-cell transcription factor Notch2 in splenic marginal zone lymphoma.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15044019 2004 HBZ interacts with JunD and stimulates its transcriptional activity.
14559791 2003 Menin, a tumor suppressor, represses JunD-mediated transcriptional activity by association with an mSin3A-histone deacetylase complex.
12727841 2003 Constitutive activation of nuclear factor kappaB p50/p65 and Fra-1 and JunD is essential for deregulated interleukin 6 expression in prostate cancer.
12615916 2003 Characterization of human constitutive photomorphogenesis protein 1, a RING finger ubiquitin ligase that interacts with Jun transcription factors and modulates their transcriptional activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226747 2002 Menin uncouples Elk-1, JunD and c-Jun phosphorylation from MAP kinase activation.
12193410 2002 An activator protein-1 complex mediates epidermal growth factor regulation of equine glycoprotein alpha subunit expression in trophoblast cells.
12165517 2002 Repression of AP-1 function: a mechanism for the regulation of Blimp-1 expression and B lymphocyte differentiation by the B cell lymphoma-6 protooncogene.
12105216 2002 Translational regulation of the JunD messenger RNA.
12082101 2002 Ultraviolet-induced junD activation and apoptosis in myeloblastic leukemia ML-1 cells.
12080089 2002 JunB potentiates function of BRCA1 activation domain 1 (AD1) through a coiled-coil-mediated interaction.
12054733 2002 Luteinizing hormone-releasing hormone induces JunD-DNA binding and extends cell cycle in human ovarian cancer cells.
12052862 2002 Retinoic acid receptors inhibit AP1 activation by regulating extracellular signal-regulated kinase and CBP recruitment to an AP1-responsive promoter.
12052834 2002 Regulation of two JunD isoforms by Jun N-terminal kinases.
12032852 2002 The TRC8 hereditary kidney cancer gene suppresses growth and functions with VHL in a common pathway.
11903046 2002 An alternative model of H ferritin promoter transactivation by c-Jun.
11221882 2001 Differential binding of the Menin tumor suppressor protein to JunD isoforms.
10942775 2000 Critical role of Smads and AP-1 complex in transforming growth factor-beta -dependent apoptosis.
10934195 2000 Regulation of AP1 (Jun/Fos) factor expression and activation in ovarian granulosa cells. Relation of JunD and Fra2 to terminal differentiation.
10713367 2000 Interleukin-1beta induction of the chemokine RANTES promoter in the human astrocytoma line CH235 requires both constitutive and inducible transcription factors.
10523647 1999 CHOP enhancement of gene transcription by interactions with Jun/Fos AP-1 complex proteins.
10220381 1999 Smads bind directly to the Jun family of AP-1 transcription factors.
9989505 1999 Menin interacts with the AP1 transcription factor JunD and represses JunD-activated transcription.
9872330 1998 Nrf2 and Nrf1 in association with Jun proteins regulate antioxidant response element-mediated expression and coordinated induction of genes encoding detoxifying enzymes.
9739985 1998 Decreased transcription factor junD in brains of patients with Down syndrome.
8945519 1996 c-Jun can recruit JNK to phosphorylate dimerization partners via specific docking interactions.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8837781 1996 A new group of conserved coactivators that increase the specificity of AP-1 transcription factors.
8570175 1995 B-ATF: a novel human bZIP protein that associates with members of the AP-1 transcription factor family.
8432525 1993 Fluorescence in situ hybridization mapping of human chromosome 19: cytogenetic band location of 540 cosmids and 70 genes or DNA markers.
8152431 1994 Activating transcription factor-3 stimulates 3',5'-cyclic adenosine monophosphate-dependent gene expression.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7848298 1995 In vitro association between the Jun protein family and the general transcription factors, TBP and TFIIB.
2112242 1990 Isolation of human cDNA clones of jun-related genes, jun-B and jun-D.
1903194 1991 Structure and function of human jun-D.
1899335 1991 Expression of c-jun, jun B and jun D proto-oncogenes in human peripheral-blood granulocytes.