Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.64
PubTator Score 1.67

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
colon cancer 1.600 3.2e-02
gastric cancer 1.200 9.0e-03
hepatocellular carcinoma 1.300 1.9e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.5e-02
invasive ductal carcinoma -1.200 2.5e-02
lung cancer 1.500 1.2e-03
osteosarcoma -1.179 2.8e-03
pancreatic cancer 1.100 2.3e-02
pancreatic carcinoma 1.100 2.3e-02
psoriasis -2.400 1.3e-04
tuberculosis and treatment for 3 months -1.200 2.2e-03

AA Sequence

YLEQQGDMILPDRLVIRKLRATIRNKQKMTKSSQ                                        491 - 524

Text Mined References (9)

PMID Year Title