Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.31
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
glioblastoma 5572 3.2e-03
Disease Target Count Z-score Confidence
Machado-Joseph disease 18 3.923 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
glioblastoma 1.100 3.2e-03

Synonym

Accession Q8TAC2 M0QX25
Symbols SBBI54

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

AA Sequence

MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDV      1 - 70
NVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLD     71 - 140
SKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD                          141 - 188
//

Text Mined References (11)

PMID Year Title
23625928 2013 JosD1, a membrane-targeted deubiquitinating enzyme, is activated by ubiquitination and regulates membrane dynamics, cell motility, and endocytosis.
21118805 2011 Crystal structure of a Josephin-ubiquitin complex: evolutionary restraints on ataxin-3 deubiquitinating activity.
17696782 2007 Josephin domain-containing proteins from a variety of species are active de-ubiquitination enzymes.
16611142 2006 Cytokine-regulated protein degradation by the ubiquitination system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12486728 2003 Structural modeling of ataxin-3 reveals distant homology to adaptins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.