Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.43
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
glioblastoma 5792 3.2e-03
Disease Target Count Z-score Confidence
Machado-Joseph disease 18 3.432 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
glioblastoma 1.100 3.2e-03

AA Sequence

MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDV      1 - 70
NVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLD     71 - 140
SKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD                          141 - 188
//

Text Mined References (11)

PMID Year Title