Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 2.4e-02

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.400 2.4e-02

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MVTGGAHSRSRGGLPSASRRGLFRGGPKEVTSGVRPGSRPLPRRRSCRPMAGGWAQGSRRAARLPEGGRL      1 - 70
MAPASRLLALWALAAVALPGSGAEGDGGWRPGGPGAVAEEERCTVERRADLTYAEFVQQYAFVRPVILQG     71 - 140
LTDNSRFRALCSRDRLLASFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDNN    141 - 210
FTEWASLFRHYSPPPFGLLGTAPAYSFGIAGAGSGVPFHWHGPGYSEVIYGRKRWFLYPPEKTPEFHPNK    211 - 280
TTLAWLRDTYPALPPSARPLECTIRAGEVLYFPDRWWHATLNLDTSVFISTFLG                    281 - 334
//

Text Mined References (10)

PMID Year Title