Property Summary

NCBI Gene PubMed Count 46
PubMed Score 671.45
PubTator Score 101.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia 1.300 4.0e-02
adult high grade glioma -1.200 5.2e-03
atypical teratoid / rhabdoid tumor -1.600 1.8e-04
ependymoma -1.100 3.8e-02
glioblastoma 1.400 2.2e-03
group 3 medulloblastoma 1.300 6.1e-03
lung cancer -1.400 1.5e-02
medulloblastoma, large-cell -1.100 1.5e-02
non primary Sjogren syndrome sicca 1.200 2.3e-02
osteosarcoma -1.578 5.8e-04
ovarian cancer 1.500 1.3e-05
psoriasis -1.200 2.3e-08

Gene RIF (29)

AA Sequence

MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV      1 - 70
VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH     71 - 140
PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP    141 - 210
TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT    211 - 280
TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS    281 - 350
SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR                     351 - 403
//

Text Mined References (50)

PMID Year Title