Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.59
PubTator Score 2.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (6)

PMID Text
25173965 synergistic function of Jnk1 in haematopoietic cells and hepatocytes might be relevant for the development of chronic liver injury
23798571 Expression of DP, a receptor largely retained in the ER, promoted proteasome recruitment by JAMP.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19269966 RNF5 associates with JAMP in the ER membrane. This association results in Ubc13-dependent RNF5-mediated noncanonical ubiquitination of JAMP.
18784250 JAMP is an important component for coordinated clearance of misfolded proteins from the endoplasmic reticulum.
16166642 Identification and functional characterization of the mouse Jamp ortholog.

AA Sequence

MFGAAARSADLALLEKNLQAAHGCLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPEL      1 - 70
YDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIITLLVSDPVGVLYIRSCRVLML     71 - 140
SDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAA    141 - 210
LYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGI    211 - 280
ISISRVDKLEQDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH                            281 - 326
//

Text Mined References (15)

PMID Year Title
25173965 2015 Haematopoietic cell-derived Jnk1 is crucial for chronic inflammation and carcinogenesis in an experimental model of liver injury.
23798571 2013 Novel, gel-free proteomics approach identifies RNF5 and JAMP as modulators of GPCR stability.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19269966 2009 Regulation of endoplasmic reticulum-associated degradation by RNF5-dependent ubiquitination of JNK-associated membrane protein (JAMP).
18784250 2008 JAMP optimizes ERAD to protect cells from unfolded proteins.
16381901 2006 The LIFEdb database in 2006.
16166642 2005 JAMP, a Jun N-terminal kinase 1 (JNK1)-associated membrane protein, regulates duration of JNK activity.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12800201 2003 Novel tumor antigens identified by autologous antibody screening of childhood medulloblastoma cDNA libraries.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.