Property Summary

NCBI Gene PubMed Count 40
PubMed Score 355.77
PubTator Score 222.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active ulcerative colitis -3.586 2.7e-02
adult high grade glioma 1.200 1.2e-02
Breast cancer -5.600 2.2e-02
breast carcinoma -1.900 5.2e-12
chronic kidney disease 2.400 4.5e-02
Chronic Lymphocytic Leukemia -3.606 7.3e-04
colon cancer -1.700 1.4e-02
Common variable immunodeficiency -3.307 2.7e-06
cutaneous lupus erythematosus 2.100 7.1e-03
ependymoma 1.100 3.8e-02
intraductal papillary-mucinous carcinoma... -3.100 1.3e-02
intraductal papillary-mucinous neoplasm ... -4.400 9.8e-03
lung adenocarcinoma -1.100 1.1e-02
lung cancer -5.600 1.5e-06
lung carcinoma -4.400 1.3e-15
malignant mesothelioma -7.200 4.9e-10
mucosa-associated lymphoid tissue lympho... 2.209 4.3e-02
osteosarcoma -5.904 4.8e-06
pancreatic cancer 1.400 2.9e-02
periodontitis 1.200 1.2e-15
pituitary cancer -1.100 2.0e-02
primary pancreatic ductal adenocarcinoma 1.931 3.8e-02
psoriasis -2.500 7.9e-04
tuberculosis 1.700 2.6e-03
Waldenstrons macroglobulinemia 1.157 4.8e-03
X-linked agammaglobulinemia -3.292 3.9e-06

Gene RIF (3)

AA Sequence

MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRE      1 - 70
NISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVY     71 - 140
GGETKMVETALTPDACYPD                                                       141 - 159
//

Text Mined References (46)

PMID Year Title