Property Summary

NCBI Gene PubMed Count 39
PubMed Score 350.28
PubTator Score 222.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.157 4.8e-03
chronic lymphocytic leukemia -3.606 7.3e-04
malignant mesothelioma -7.200 4.9e-10
cutaneous lupus erythematosus 2.100 7.1e-03
psoriasis -2.500 7.9e-04
osteosarcoma -5.904 4.8e-06
posterior fossa group A ependymoma 1.900 1.9e-03
periodontitis 1.200 1.2e-15
chronic kidney disease 2.400 4.5e-02
tuberculosis 1.700 2.6e-03
primary pancreatic ductal adenocarcinoma 1.931 3.8e-02
X-linked agammaglobulinemia -3.292 3.9e-06
Common variable immunodeficiency -3.307 2.7e-06
intraductal papillary-mucinous carcinoma... -3.100 1.3e-02
intraductal papillary-mucinous neoplasm ... -4.400 9.8e-03
colon cancer -4.200 2.6e-02
lung cancer -7.900 2.1e-07
active ulcerative colitis -3.586 2.7e-02
Breast cancer -5.600 2.2e-02
adult high grade glioma 1.200 1.2e-02
lung adenocarcinoma -1.100 1.1e-02
lung carcinoma -4.400 1.3e-15
breast carcinoma -1.900 5.2e-12
mucosa-associated lymphoid tissue lympho... 2.209 4.3e-02
pituitary cancer -1.100 2.0e-02
pancreatic cancer 1.400 2.9e-02

Gene RIF (2)

PMID Text
20947433 TLR2 ligands induce CCR9 and CCR10 expression by circulating B-cells and increase their chemotaxis. TLR2 stimulation also induced J chain and IgA production demonstrating the induction of mucosal-like antibody secreting cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRE      1 - 70
NISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVY     71 - 140
GGETKMVETALTPDACYPD                                                       141 - 159
//

Text Mined References (45)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
24706782 2014 Expression and glycoengineering of functionally active heteromultimeric IgM in plants.
24145934 2013 Characterization, quantification, and assessment of immune protection potential of secretory immunoglobulin A in colostrum samples from Saudi women.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23398317 2013 Defective immunoglobulin A (IgA) glycosylation and IgA deposits in patients with IgA nephropathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23250751 2013 Human plasma-derived polymeric IgA and IgM antibodies associate with secretory component to yield biologically active secretory-like antibodies.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21786026 2011 Antigenic specificity and expression of a natural idiotope on human pentameric and hexameric IgM polymers.
21269460 2011 Initial characterization of the human central proteome.
20947433 2011 Toll-like receptor 2 induces mucosal homing receptor expression and IgA production by human B cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
17237408 2007 Secretory antibody formation: conserved binding interactions between J chain and polymeric Ig receptor from humans and amphibians.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15084671 2004 A proteomic analysis of human bile.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8683109 1996 Mutagenesis of the human IgA1 heavy chain tailpiece that prevents dimer assembly.
8666793 1996 The J chain gene is transcribed during B and T lymphopoiesis in humans.
8253928 1993 Glandular distribution of immunoglobulins, J chain, secretory component, and HLA-DR in the human endometrium throughout the menstrual cycle.
8196286 1994 Expression of J chain mRNA in duodenal IgA plasma cells in IgA nephropathy.
8168154 1993 Early expression of human J chain and mu chain gene in the fetal liver.
7664491 1995 Increased dimeric IgA-producing B cells in tonsils in IgA nephropathy determined by in situ hybridization for J chain mRNA.
6774844 1980 J chain synthesis in human myeloma cells: light and electron microscopic studies.
6417260 1983 Ultrastructural studies of human lymphoid cells. mu and J chain expression as a function of B cell differentiation.
3146624 1988 Immunoelectron microscopical localization of immunoglobulins, secretory component and J chain in the human minor salivary glands.
3016707 1986 Human J chain gene: chromosomal localization and associated restriction fragment length polymorphisms.
2984306 1985 Human J chain gene. Structure and expression in B lymphoid cells.
2415140 1985 The coming of age of the immunoglobulin J chain.
2120591 1990 Secretion of immunoglobulin M assembly intermediates in the presence of reducing agents.
2113434 1990 Immunoglobulin A (IgA) polymerization sites in human immunocytes: immunoelectron microscopic study.
1472500 1992 Disulfide bond assignment in human J chain and its covalent pairing with immunoglobulin M.
1292512 1992 Intra- and interchain disulfide bridges of the human J chain in secretory immunoglobulin A.
407930 1977 Primary structure of human J chain: alignment of peptides from chemical and enzymatic hydrolyses.
115892 1979 Plasma cell immunoglobulin M molecules. Their biosynthesis, assembly, and intracellular transport.