Property Summary

NCBI Gene PubMed Count 27
PubMed Score 51.58
PubTator Score 37.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
nephrosclerosis 1.111 1.8e-03
astrocytoma 2.100 4.7e-03
oligodendroglioma 1.500 3.5e-02
glioblastoma 1.700 9.2e-03
group 4 medulloblastoma -2.400 7.2e-07
cystic fibrosis 1.586 6.2e-05
medulloblastoma, large-cell -2.400 8.5e-03
Duchenne muscular dystrophy 1.135 2.2e-06
adrenocortical carcinoma -2.029 8.2e-03
non-small cell lung cancer -2.936 1.1e-30
intraductal papillary-mucinous adenoma (... -2.200 1.2e-04
intraductal papillary-mucinous carcinoma... -2.300 1.3e-04
intraductal papillary-mucinous neoplasm ... -2.300 2.4e-03
lung cancer -4.400 5.9e-07
colon cancer -2.100 1.0e-02
breast carcinoma -1.500 2.7e-32
lung adenocarcinoma -2.300 3.3e-23
pediatric high grade glioma 1.300 5.3e-05
primary Sjogren syndrome 1.400 4.3e-04
acute myeloid leukemia -1.400 3.1e-03
invasive ductal carcinoma -3.000 8.4e-05
Breast cancer -1.600 2.3e-04
lung carcinoma -1.900 9.4e-11
mucosa-associated lymphoid tissue lympho... -1.202 2.2e-02
ductal carcinoma in situ -1.900 3.5e-04
ulcerative colitis 1.300 1.1e-04
ovarian cancer -1.600 1.2e-06

Protein-protein Interaction (1)

Gene RIF (12)

PMID Text
25649652 This study showed thatJAM2 (rs2829841; intronic), associated with Alzheimer disease.
24357068 Function of Jam-B/Jam-C interaction in homing and mobilization of human and mouse hematopoietic stem and progenitor cells.
23277282 These data brought new evidences for the role of JAM2 and JAM3 in progression of gastric adenocarcinoma
20624003 The expression of tight junction proteins ZO-1, JAM-2, Occludin, Claudin-3 and Claudin-5 is modulated by HIV-1 gp120, and the modulated TJ expression involves Rho-A activation
18574677 The expression of tight junction proteins ZO-1, JAM-2, Occludin, Claudin-3 and Claudin-5 is modulated by HIV-1 gp120, and the modulated TJ expression involves Rho-A activation
18329007 The expression of tight junction proteins ZO-1, JAM-2, Occludin, Claudin-3 and Claudin-5 is modulated by HIV-1 gp120, and the modulated TJ expression involves Rho-A activation
17822725 Examine JAM-2 expression in normal/inflammed lymphatic endothelium.
12476045 Results suggest a role for junctional adhesion molecule-2 (JAM-2) in facilitating transmigration in endothelial cells
12070135 interacts with alpha4beta1; Facilitation by JAM3
12070135 Discovery as ligand for the integrin alpha4beta1
11823489 role as an adhesive ligand for interacting with a variety of immune cell types
10945976 Cloning and discovery as adhesion receptor for T cells

AA Sequence

MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSV      1 - 70
SFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCE     71 - 140
VPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTG    141 - 210
EYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSS    211 - 280
KATTMSENDFKHTKSFII                                                        281 - 298
//

Text Mined References (27)

PMID Year Title
25649652 2015 Linking Genetics of Brain Changes to Alzheimer's Disease: Sparse Whole Genome Association Scan of Regional MRI Volumes in the ADNI and AddNeuroMed Cohorts.
24357068 2014 Function of Jam-B/Jam-C interaction in homing and mobilization of human and mouse hematopoietic stem and progenitor cells.
23277282 2013 Junctional adhesion molecules 2 and 3 may potentially be involved in progression of gastric adenocarcinoma tumors.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
17822725 2008 Expression of junctional adhesion molecules on the human lymphatic endothelium.
17525755 2007 The role of junctional adhesion molecules in vascular inflammation.
16381901 2006 The LIFEdb database in 2006.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14519386 2003 The JAM family of junctional adhesion molecules.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12953056 2003 The junctional adhesion molecule (JAM) family members JAM-2 and JAM-3 associate with the cell polarity protein PAR-3: a possible role for JAMs in endothelial cell polarity.
12810109 2003 Leukocyte-endothelial-cell interactions in leukocyte transmigration and the inflammatory response.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12476045 2002 Junctional adhesion molecules and interendothelial junctions.
12070135 2002 JAM2 interacts with alpha4beta1. Facilitation by JAM3.
12036298 2002 Annotation of human chromosome 21 for relevance to Down syndrome: gene structure and expression analysis.
11823489 2002 Vascular endothelial-junctional adhesion molecule (VE-JAM)/JAM 2 interacts with T, NK, and dendritic cells through JAM 3.
11590146 2001 Cloning of human junctional adhesion molecule 3 (JAM3) and its identification as the JAM2 counter-receptor.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10945976 2000 A novel protein with homology to the junctional adhesion molecule. Characterization of leukocyte interactions.
10830953 2000 The DNA sequence of human chromosome 21.
10779521 2000 Vascular endothelial junction-associated molecule, a novel member of the immunoglobulin superfamily, is localized to intercellular boundaries of endothelial cells.