Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.28
PubTator Score 7.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.600 3.4e-05
astrocytic glioma -2.500 4.2e-03
Astrocytoma, Pilocytic -3.600 8.3e-11
atypical teratoid / rhabdoid tumor -3.600 1.1e-09
ependymoma -2.900 7.3e-03
glioblastoma -2.500 8.5e-09
group 3 medulloblastoma -3.000 7.6e-04
medulloblastoma, large-cell -2.500 1.2e-03
oligodendroglioma -2.100 1.6e-02
pituitary cancer -1.600 2.1e-03
primitive neuroectodermal tumor -3.300 9.3e-05
psoriasis 1.900 4.4e-31
tuberculosis 2.000 2.1e-05

Gene RIF (7)

AA Sequence

MSKKGRSKGEKPEMETDAVQMANEELRAKLTSIQIEFQQEKSKVGKLRERLQEAKLEREQEQRRHTAYIS      1 - 70
ELKAKLHEEKTKELQALREGLIRQHEQEAARTAKIKEGELQRLQATLNVLRDGAADKVKTALLTEAREEA     71 - 140
RRAFDGERLRLQQEILELKAARKQAEEALSNCMQADKTKAADLRAAYQAHQDEVHRIKRECERDIRRLMD    141 - 210
EIKGKDRVILALEKELGVQAGQTQKLLLQKEALDEQLVQVKEAERHHSSPKRELPPGIGDMVELMGVQDQ    211 - 280
HMDERDVRRFQLKIAELNSVIRKLEDRNTLLADERNELLKRSRETEVQLKPLVEKNKRMNKKNEDLLQSI    281 - 350
QRMEEKIKNLTRENVEMKEKLSAQASLKRHTSLNDLSLTRDEQEIEFLRLQVLEQQHVIDDLSLERERLL    351 - 420
RSKRHRGKSLKPPKKHVVETFFGFDEESVDSETLSETSYNTDRTDRTPATPEEDLDDATAREEADLRFCQ    421 - 490
LTREYQALQRAYALLQEQVGGTLDAEREARTREQLQADLLRCQAKIEDLEKLLVEKGQDSKWVEEKQLLI    491 - 560
RTNQDLLEKIYRLEMEENQLKNEMQDAKDQNELLEFRVLELEVRDSICCKLSNGADILFEPKLKFM        561 - 626
//

Text Mined References (21)

PMID Year Title