Property Summary

Ligand Count 1,354
NCBI Gene PubMed Count 1,308
PubMed Score 3339.72
PubTator Score 2952.78

Knowledge Summary

Patent (135,858)

TINX Plot

  Disease (9)

Disease Target Count
Thrombocytopenia 197
Abdominal Pain 98
Acute blood cancer 6
Acute leukemia 15
Amaurosis Fugax 8
Angina Pectoris 32
Arterial thrombosis 9
Arthralgia 90
Ascites 22
Bleeding tendency 37
Bleeding time prolonged 31
Brain Ischemia 110
Brain hemorrhage 14
Cerebral Hemorrhage 42
Cerebral Ischemia 37
Chest Pain 38
Decreased platelet count 111
Dizziness 26
Dyspnea on exertion 24
Ecchymosis 66
Elevated hepatic transaminases 81
Embolism and Thrombosis 6
Epistaxis 43
Esophageal Varices 6
Fatigue 182
Fever 138
Florid red complexion (finding) 3
Gastrointestinal Hemorrhage 52
Gingival Hemorrhage 18
Headache 37
Heart valve disease 39
Hematocrit increased 5
Hemoglobin increased 6
Hepatic enzyme increased 81
Hepatomegaly 285
Hyperhidrosis disorder 81
Hypertension, Portal 22
Hypertensive disease 292
Hypoplastic myelodysplasia 18
Increase in blood pressure 119
Increased megakaryocyte count 6
Increased number of platelets 14
Increased red blood cell mass 4
Increased sweating 81
Increased tendency to bruise 66
Isolated cases 72
Leukemia, Myelocytic, Acute 120
Leukocytosis 17
Liver Cirrhosis 181
Liver Dysfunction 99
Liver enzymes abnormal 81
Liver function test increased 81
Liver function tests abnormal finding 81
MYELODYSPLASTIC SYNDROME 53
Myeloproliferative disease 16
Myocardial Infarction 151
Paresthesia 32
Peripheral arterial occlusive disease 4
Peripheral thrombosis 3
Peripheral vascular insufficiency 4
Platelet morphology abnormal 9
Pruritus 58
Respiratory Insufficiency 132
Respiratory function loss 121
Somatic mutation 61
Splenomegaly 190
Spontaneous abortion 113
Subclinical abnormal liver function tests 81
Sweating 81
THROMBOCYTHEMIA 1 3
THROMBOCYTHEMIA 2 3
Tinnitus 19
Transaminases increased 81
Transient Cerebral Ischemia 25
Vertigo 29
Weight decreased 103
vascular disease occlusive 4
Disease Target Count Z-score Confidence
Cancer 2499 6.346 3.2

Expression

  Differential Expression (10)

Disease log2 FC p
ulcerative colitis 1.300 1.7e-06
cystic fibrosis -1.189 9.7e-05
malignant mesothelioma -1.300 2.2e-06
medulloblastoma, large-cell -1.100 5.8e-04
osteosarcoma -1.560 4.0e-04
ovarian cancer -1.100 2.9e-07
primary Sjogren syndrome 1.100 3.7e-03
Systemic lupus erythematosus 1.100 9.0e-04
tuberculosis 2.000 3.9e-06
urothelial carcinoma -1.200 2.6e-03

PDB (72)

Gene RIF (1230)

AA Sequence

MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSGEYVAEEICIA      1 - 70
ASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYFPRWYCSGSNRAYRHGISRGA     71 - 140
EAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKENDQTPLAIYNSISYKTFL    141 - 210
PKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPS    211 - 280
GEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGK    281 - 350
NLEIELSSLREALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT    351 - 420
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDN    421 - 490
IIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKIRNEDLIFNESLGQGTFTKIF    491 - 560
KGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVK    561 - 630
FGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDP    631 - 700
GISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRH    701 - 770
QLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD    771 - 840
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNI    841 - 910
VKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATR    911 - 980
NILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTY    981 - 1050
IEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLA   1051 - 1120
LRVDQIRDNMAG                                                             1121 - 1132
//

Text Mined References (1318)

PMID Year Title