Property Summary

Ligand Count 1,100
NCBI Gene PubMed Count 241
PubMed Score 518.70
PubTator Score 368.60

Knowledge Summary

Patent (42,110)

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid arthritis 3.300 1.5e-05
astrocytoma 1.400 5.4e-03
atypical teratoid / rhabdoid tumor 1.300 1.3e-02
dermatomyositis 1.100 2.2e-03
ependymoma 1.100 2.0e-02
group 4 medulloblastoma 1.300 3.0e-02
lung cancer -1.800 1.8e-03
malignant mesothelioma -1.200 7.8e-07
medulloblastoma, large-cell -1.300 4.6e-05
Multiple myeloma 1.792 4.3e-03
osteosarcoma 2.061 8.9e-06
ovarian cancer -2.400 4.2e-08
pancreatic cancer -1.200 4.3e-02
pancreatic carcinoma -1.200 4.3e-02
pituitary cancer -1.100 3.9e-02

Protein-protein Interaction (12)

PDB (24)

Gene RIF (180)

AA Sequence

MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRI      1 - 70
SPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEK     71 - 140
KKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPE    141 - 210
LPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKH    211 - 280
YGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKH    281 - 350
KKDEEKNKIREEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH    351 - 420
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQVQG    421 - 490
AQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLKRCCQPKPREISNLLVATKK    491 - 560
AQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRD    561 - 630
ISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLAS    631 - 700
ALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNL    701 - 770
SVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA    771 - 840
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSL    841 - 910
KPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQ    911 - 980
LKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAP    981 - 1050
ECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNC   1051 - 1120
PDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK                                       1121 - 1154
//

Text Mined References (248)

PMID Year Title