Property Summary

NCBI Gene PubMed Count 215
PubMed Score 1096.75
PubTator Score 477.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Kidney disease 397 0.0 2.0
Osteoporosis 259 0.0 2.0
Disease Target Count Z-score Confidence
Alagille syndrome 15 0.0 5.0

Expression

  Differential Expression (28)

Disease log2 FC p
glioblastoma 2.400 1.6e-03
ependymoma 2.300 2.8e-02
psoriasis -2.400 6.8e-05
astrocytoma 1.600 2.3e-02
oligodendroglioma 1.400 5.8e-09
osteosarcoma 1.598 2.9e-02
cystic fibrosis -4.242 4.5e-08
atypical teratoid/rhabdoid tumor 2.000 7.2e-04
medulloblastoma, large-cell -1.100 2.8e-03
primitive neuroectodermal tumor 2.500 5.0e-04
Duchenne muscular dystrophy 1.074 1.6e-06
autosomal dominant Emery-Dreifuss muscul... 1.048 6.5e-03
juvenile dermatomyositis 1.189 1.9e-10
adrenocortical carcinoma 2.286 4.8e-03
tuberculosis -1.400 1.7e-03
primary pancreatic ductal adenocarcinoma 1.499 3.0e-02
non-small cell lung cancer 1.200 9.4e-05
intraductal papillary-mucinous adenoma (... 1.300 1.2e-02
lung cancer 1.800 1.2e-04
pediatric high grade glioma 2.300 3.0e-05
group 3 medulloblastoma 1.100 2.5e-02
pilocytic astrocytoma 1.700 1.5e-06
aldosterone-producing adenoma -1.106 2.2e-02
subependymal giant cell astrocytoma 1.276 3.8e-02
lung carcinoma 3.000 1.0e-39
gastric carcinoma 1.500 3.9e-02
pancreatic cancer 1.300 3.7e-02
dermatomyositis 1.500 2.3e-02

 GWAS Trait (1)

Gene RIF (180)

PMID Text
27487663 Expression of Jag-1 in dermal microvessels was enhanced from 20 weeks of gestation to 85 years.
26930648 SCC patients with higher JAG1 transcription had poor overall survival.
26926447 Immunohistochemical panel of CDX2, p120ctn, c-Myc, and Jagged1 proteins would be to distinguish between low/high grade dysplasia in histologically challenging cases of Barrett's esophagus.
26921446 bone marrow stroma induces Jagged1 expression in bone metastatic prostate cancer PC3 cells, and this enhanced expression is mechanistically linked to the promotion of cell migration
26779814 Jag1 is upregulated preferentially in pulmonary capillary endothelial cells in individuals with interstitial pulmonary fibrosis compared to normal lung.
26760175 Alagille syndrome type 1 patients have an increased risk of nonautoimmune hypothyroidism, and that variations in JAG1 gene can contribute to the pathogenesis of variable congenital thyroid defects.
26721293 Jagged1 expression was correlated with higher tumor grade and invasion of breast carcinomas.
26679605 Our collective results clearly indicate that miR-186 functions as a tumor suppressor in MM, supporting its potential as a therapeutic target for the disease.
26648562 these findings demonstrate that 50 microM EGCG protects against ox-LDL-induced endothelial dysfunction through the Jagged-1/Notch signaling pathway.
26646450 findings provide evidence for a novel cell-autonomous pro-inflammatory Jagged1-Notch1 pathway in endothelial cells
26618708 Data do not support association of biliary atresia with JAG1 mutations, at least in Czech patients. Rapid testing for JAG1 mutations could prevent misdiagnosis of Alagille syndrome in early infancy and improve their outcome.
26548814 Expression and conditional gene knockout studies of JAG1 (Jag1) have correlated with tissue-specific disease phenotypes and have provided insight into both disease pathogenesis and human development
26546995 DLL4 and JAG1 may have opposing effects on tumor angiogenesis in glioblastoma.
26406415 High Jagged1 expression is associated with colorectal cancer.
26387946 Anti-estrogen resistance in human breast tumors is driven by JAG1-NOTCH4-dependent cancer stem cell activity.
26350262 PKCalpha Attenuates Jagged-1-Mediated Notch Signaling in ErbB-2-Positive Breast Cancer to Reverse Trastuzumab Resistance
26341090 High Jagged1 expression is associated with Prostatic Intraepithelial Neoplasia.
26339425 Case Report: JAGGED1 gene variations in Chinese twin sisters with Alagille syndrome.
26276215 Jagged1 is a novel binding partner of Fe65, and Fe65 may act as a novel effector of Jagged1 signaling.
26076142 JAG1 mutations are present in the majority of Chinese pediatric patients with clinical features of Alagille syndrome, and the mutations concentrate on different exons from other reports.
25903338 Transient expression of the human cytomegalovirus tegument proteins of pp71 and UL26 reduced NICD1 and Jag1 protein levels endogenously and exogenously.
25842263 It is also proved that Notch1 and JAGD1 expression were to be associated with cervical cancer invasion, lymph node metastasis, and FIGO system.
25825216 Vehicular exhaust particles activate an AhR-Jag1-Notch1 cascade to promote allergic airway inflammation in concert with proasthmatic alleles.
25514871 EGFRvIII-mediated radioresistance, but not chemoresistance, was also modulated by JAGGED1
25424769 Jagged1 expression may be used as an independent prognosis factor in patients with glioblastoma
25400810 Report no significant association between jagged 1 polymorphisms and bone mineral density in Chinese postmenopausal women.
25380486 Data indicate the role for endothelial Jagged1 protein to promote breast tumor through notch protein activation.
25368251 High cytoplasmic Jagged1 expression is associated with laryngeal cancer.
25257302 silencing prevents Notch2-driven osteoclast development and bone destruction in multiple myeloma
25176314 our results suggest that the JAG1/Notch1/OPN cascade represents a potential therapeutic target for hepatocellular carcinoma metastasis.
24907271 Although Jag1 shares a high degree of homology with Jag2 in the ectodomain region, BACE1 fails to cleave Jag2 effectively, indicating a selective cleavage of Jag1.
24861552 Results show an association between sequence variants close to JAG1 at 20p12.2 and the risk of urinary bladder cancer.
24844362 Data show that the median expression of Jagged-1 protein and delta-like 1 protein (Dll-1) was significantly higher in acute myeloid leukemia (AML) blasts than in peripheral blood stem cells (PBSCs).
24788939 Data suggest that extracellular signal-regulated kinases ERK1/2 signaling can cross-interact with the transforming growth factor beta2/Smad2/3 and the Jagged-1/Notch-3 signaling in retinal pigment epithelium cells epithelial-mesenchymal transition.
24748328 JAG1 gene mutations are associated with Alagille syndrome.
24722295 downregulation of Jagged1 with lentiviral Jagged1-shRNA resulted in decreased colon cancer cell viability in vitro.
24708907 This study demonistrated that NOTCH ligands JAG1 and JAG2 as critical pro-survival factors in childhood medulloblastoma.
24659709 Study suggests that the epigenetic silencing of miR-199b-5p during tumor progression is significantly associated with acquired chemoresistance in ovarian cancer through the activation of JAG1-Notch1 signaling.
24604720 A random population of LNCaP prostate cancer cells comprises a heterogeneous group of cells with different androgen-deprivation sensitivities and potential for invasiveness; expression levels of 2 genes known to be regulated by miR-21, an androgen-regulated microRNA, SPRY1 and JAG1 were lower in an androgen insensitive clone, than an androgen sensitive clone.
24573085 Short-term activation of Notch signaling by jagged-1 enhances store-operated calcium entry in pulmonary artery smooth muscle.
24239355 the N terminus of human Jagged-1 is a C2 phospholipid recognition domain that binds phospholipid bilayers in a calcium-dependent fashion.
24138322 3D coculture induced an upregulation of Notch3 receptor in human coronary artery smooth muscle cells and its ligand Jagged1 in human coronary artery endothelial cells.
23956173 We hypothesize that a similar mechanism could be present in this patient with del22q11.2 syndrome associated with a JAG1 missense mutation acting as possible modifier factor for tetralogy of Fallot
23934482 our results indicate that NF-kappaB has a non-cell-autonomous role in regulating cancer stem cell populations by forming intratumoural microenvironments composed of JAG1-expressing non-cancer stem cells with a basal-like subtype.
23758219 Overexpression of Jagged-1 and its intracellular domain in human mesenchymal stromal cells differentially affect the interaction with hematopoietic stem and progenitor cells.
23752887 The role of NOTCH2 and JAG1 in formation of proximal nephron structures and podocytes might explain the observed phenotypes of renal dysplasia and proteinuria in patients with Alagille syndrome and renal tubular acidosis.
23416080 the juxtamembrane region of Jagged-1, one of the Notch ligands, behaves as a structured module and is cleaved by ADAM17 catalytic domain at E1054.
23379739 derived mesenchymal stem cells (hPDLSCs) on a Jagged-1-modified surface had increased expression of Notch signaling target genes, Hes-1 and Hey-1, suggesting the involvement of Notch signaling in hPDLSCs.
23375636 High soluble form of Jagged-1 is associated with liver metastasis in colorectal cancer.
23339193 Data indicate that a Notch-1-specific monoclonal antibody blocks binding with Jagged-1/Serrate.
23300864 Overexpresion of JAG1 in endothelial cells inhibited cell proliferation, but did not affect cell migration, sprouting angiogenesis or cell adhesion.
23157415 Jagged1 may be involved in differentiation and proliferation of tongue cancer. Targeting Jagged1 RNA interference lentiviral vector can effectively lower Jagged1 mRNA and protein expression levels of Tca8113 cells preventing proliferation of TSCC cells.
23086448 Here we identified the Notch family member Jagged1 as a physiological ligand for CD46.
22871495 High jagged 1 expression is associated with glioma.
22847978 The ability to control differentiation of human periodontal ligament derived mesenchymal stem cells using modified surfaces containing the affinity immobilized Notch ligand, Jagged-1, was investigated.
22618231 these results reveal a regulatory interplay between miR-21, JAG1 and E2 that is important for advancing understanding of how the oncogenic potential of miR-21 and JAG1 manifests in different sub-types of breast cancer.
22526456 immunohistochemical analysis of NOTCH1-3, JAGGED1, cMET, and phospho-MAPK in 100 carcinomas of unknown primary
22487239 Study suggest the requirement for cell-surface localization of Jagged1 for cis-inhibition activities.
22465068 Data show that the PDZ binding motif is preceded by four alpha-helical segments and that, despite the extensive interaction between intracellular region of Jagged-1 J1_tmic and the micelle, the PDZ binding motif remains highly flexible.
22405927 These alterations were located in the extracellular domain of JAG1, in particular in the DSL and EGF-like repeat domain.
22357466 The activation of Notch1 signal is common in children with acute leukemia.
22348356 The Notch1-JAG1 axis may enhance the invasive properties of endometrial carcinomas, which suggests the Notch pathway may be a promising target for the treatment of this malignancy.
22296176 Dll4 and Jag1 are expressed in glioblastoma vasculature.
22204979 Both Notch3 and vascular smooth muscle cells differentiation marker proteins were upregulated, which were abrogated by Jagged1-specific siRNA.
22174012 We did not find an association of rs2273061 polymorphism in JAG1 in Mexican-Mestizo postmenopausal women with osteoporosis.
22080880 Notch1, Jagged1, and Delta1 expressions might be useful markers for clinical prognosis of ovarian carcinomas. Jagged1 could be a marker for tumor grades.
22040217 Several JAG1 mutations were found in patients with tetralogy of Fallot.
22020917 DLL4 and Jagged1 siRNA gene therapy mediated by adenovirus may be useful for inhibiting growth and invasion of SGC7901 through a Notch/VEGF pathway.
21911304 as compared to MSC, OP9 cells were more efficient at inducing self-renewal and/or de novo generation of primitive (CD34(+) CD38(-) Lin(-)) cells, and suggest that such effects were due, at least in part, to the presence of Jagged-1 and DL1.
21893051 Disease-associating novel JAG1 gene variations were found in TOF patients, and seem to play an important role in the causation of the disease
21866461 Epigallocatechin-3-gallate upregulated JAG1 gene expression in HT29 and HCT-8 cells, more so in HCT-8 cells.
21820430 The Jagged-1 intracellular domain (JICD) inhibits Notch1 signaling via a reduction in the protein stability of the Notch1 intracellular domain (Notch1-IC).
21810559 Notch signaling molecules, Notch1 and Jagged1, are morphogenesis regulation factors closely related to cytological differentiation in neoplastic cells of ameloblastoma.
21757656 Endothelial JAGGED1 controls hemangioma stem cell-to-pericyte differentiation in a murine model of infantile hemangioma. Pericytes have a fundamental role in formation of blood vessels in IH.
21753153 Jagged1 plays dual roles in cancer progression through an angiogenic function in tumor endothelial cells and through proliferation and chemoresistance in tumor cells.
21752016 JAG1 mutations were identified in 59/135 (44%) probands with Alagille syndrome.
21685392 miR-143/145 as activated independently by Jag-1/Notch and SRF in parallel pathways.
21639801 NOTCH2 expression and activation, independent of JAGGED1 expression, may contribute to the pathogenesis of hepatoblastoma.
21637926 RUNX3 expression suppressed JAG1 expression and resulted in downregulation of tumorigenesis in hepatocellular carcinoma cells
21602525 The stromal cell-mediated antiapoptotic effect on B- ALL cells is mediated by Notch-3 and -4 or Jagged-1/-2 and DLL-1 in a synergistic manner.
21266409 suggest that the prosensory function of Jag1 resides in its ability to generate discrete domains of Notch activity that maintain Sox2 expression within restricted areas of an extended neurosensory-competent domain
21199807 data suggest that JAG1-induced Notch activation results in breast cancer progression through upregulation of the plasminogen activator system, directly linking these 2 important pathways of poor prognosis
21145176 Notch1 and Jagged1 are up-regulated in human colon adenocarcinoma and suggests that Notch1/Jagged1 signaling might play a role in the development of colon adenocarcinoma.
21103979 Results suggest that common variants in JAG1 are not strongly associated with diabetic nephropathy in type 1 diabetes among white individuals. Findings cannot exclude these genes from involvement in the pathogenesis of diabetic nephropathy.
21062756 High Jagged1 expression is associated with clear cell renal cell carcinoma
20953350 expression regulated by Notch3 and Wnt/beta-catenin signaling pathways in ovarian cancer
20870935 Jagged1 is an RBP-J target gene that is activated in a binary manner by TLR and Notch pathways.
20833210 data suggest that Jagged/Notch signalling is required for a subset of TGFbeta1-responsive genes, and that complex signalling pathways are involved in the crosstalk between TGFbeta1 and Notch cascades in kidney epithelia
20829885 Jagged1 protein inhibits the effects of SCF on erythroid cell expansion.
20819128 Jagged1 was significantly more highly expressed in lymph node metastasis-positive tongue carcinoma.
20819075 Jagged1 is shed by ADAM17 in a lipid-raft-independent manner, and the cytosolic domain of the former protein is not a pre-requisite for either constitutive or regulated shedding shedding.
20812035 Notch1, Jagged1 and Delta1 expression appear to be relevant prognostic markers in intermediate risk acute myeloid leukemia.
20800871 Our results indicate importance of NOTCH1 and JAGGED1 expression in plasma cell neoplasia and a possible diagnostic value of their immunohistochemical evaluation of bone marrow infiltrates for multiple myeloma.
20683201 Sequence analysis of the genes identified 27% cholestasis subjects with missense, nonsense, deletion, and splice site variants associated with disease phenotypes based on the type of mutation in the JAG1, ATP8B1, ABCB11, or ABCB4 genes.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20586101 the interaction between the PDZ domain of afadin (AF6_PDZ) and a series of polypeptides comprising the PDZ-binding motif, was studied.
20580881 JAG1 expression was significantly increased in patient with Schizophrenia.
20554499 Jagged protein 1 is involved in the cytodifferentiation of squamous odontogenic tumors of the mandible.
20517681 A Jagged-1-Notch-1 activation loop between tumor cells in head and neck cancer may function to promote tumor formation and progression.
20437614 Data identified one frameshift and two missense mutations in the tetralogy of Fallot cases, one frameshift and two missense mutations in cases with pulmonic stenosis/peripheral pulmonary stenosis/pulmonary valve atresia with intact ventricular septum.
20437614 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20096396 These results identify the JAG1 gene as a candidate for bone mineral density regulation in different ethnic groups, and it is a potential key factor for fracture pathogenesis.
20096396 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20052673 down-regulation of Notch-1 or Jagged-1 mediated inhibition of cell growth, migration and invasion, and the induction of apoptosis was in part due to inactivation of Akt, mTOR, and NF-kappaB signaling pathways.
20040020 Notch signaling may participate in controlling cell differentiation and proliferation in normal bone and COF of the jaws. Notch signaling disorder may be a molecular incident in COF occurrence and development.
20038814 Mammalian target of rapamycin regulates murine and human cell differentiation through STAT3/p63/Jagged/Notch cascade.
19948535 Observational study of gene-disease association. (HuGE Navigator)
19935714 The expression of Jagged1, a ligand for canonical Notch signaling, was restricted to enteroendocrine cells or undetectable in the mucosa of the human small and large intestine, respectively.
19915977 We show that JAG1 down-regulation reduces direct binding of Notch to the cyclin D1 promoter
19913121 Observational study of gene-disease association. (HuGE Navigator)
19816565 possible complementary role for JAG1 and DLL4 in the context of Kaposi sarcoma.
19780835 study of tetralogy of Fallot associated G274D mutation in the second epidermal growth factor repeat of Jagged-1; found the G274D mutation impairs correct folding of the epidermal growth factor module & cannot be rescued by compensative mutations
19728763 Decreased jagged1 expression is associated with hepatocellular carcinoma.
19603167 Jagged1 was marginally lower patients with immune thrombocytopenic purpura.
19586525 A single, evolutionary conserved exon defines an autonomous structural unit that, despite the minimal structural context, closely matches the structure of the same region in the entire receptor binding module.
19542446 Of two Notch ligands (Jagged 1 and Delta-like 1) expressed by follicular dendritic cells, Jagged 1 appears to have a dominant role in germinal center B lymphocyte survival in tonsillar tissue.
19460752 Knockdown of jagged 1 (JAG1; HJ1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19453261 Observational study of gene-disease association. (HuGE Navigator)
19430482 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19398721 the 3' untranslated regions of WNT1 and JAG1 were functional targets of miR-34a and miR-21 and provide evidence that these targets were translationally suppressed
19393188 TNF induction of jagged-1 in endothelial cells is NFkappaB-dependent
19204726 Observational study of gene-disease association. (HuGE Navigator)
19181211 These hematopoiesis-supportive clones also showed high gene expression of Jaggedl, a Notch ligand, as well as high potential to deposit calcium after osteogenic induction.
19150886 NOTCH3 expression is induced in mural cells through an autoregulatory loop that requires endothelial-expressed JAGGED1.
19150223 Delta1 and Jagged1 are expressed in human umbilical cord epithelial cells at the mRNA and protein level.
18784255 These data demonstrate the existence of novel cross-talk between thrombin, FGF, and Notch signaling pathways, which play important roles in vascular formation and remodeling.
18632624 Jagged-1 is the primary Notch3 ligand in ovarian carcinoma and Jagged-1/Notch3 interaction constitutes a juxtacrine loop promoting proliferation and dissemination of ovarian cancer cells within the intraperitoneal cavity
18593716 Two mutations in the NOTCH1 found in patients with left ventricular outflow tract defects reduce JAGGED1 induced signaling.
18563556 Genes more highly expressed in BRCA1-associated tumors included stathmin, osteopontin, TGFbeta2 and Jagged 1
18354251 Data show that Jagged1 are abundantly expressed in osteoarthritis.
18266235 This is the first study that explores the possible interaction between JAG1, NOTCH2, and Hey2 in the variable phenotypes observed in patients with Alagille syndrome
18192230 The results thus showed that Jag-1-mediated Notch signaling in human bone marrow stromal cells was necessary to initiate chondrogenesis, but it must be switched off for chondrogenesis to proceed.
18079963 Notch-1 and the Notch ligand Jagged-1 were expressed at significantly higher levels in CCRCC tumors than in normal human renal tissue, and the growth of primary CCRCC cells was attenuated upon inhibition of Notch signaling.
18060036 IL-6 treatment triggered Notch-3-dependent upregulation of the Notch ligand Jagged-1 and promotion of MS and MCF-7-derived spheroid growth
17990101 JAG1 expression is associated with a basal phenotype and recurrence in lymph node-negative breast cancer.
17984306 Aberrant expression of Jagged1 and Notch1 are associated with poor outcome in breast cancer
17822320 Overexpression of jagged1 is associated with breast cancer
17720887 Mutations in JAGGED1 is associated with Notch signaling inhibition and Alagille syndrome
17661408 Observational study of genotype prevalence. (HuGE Navigator)
17507991 patients with tumors expressing high levels of JAG1 protein had a worse outcome than those with tumors expressing low levels
17368936 Observational study of genotype prevalence. (HuGE Navigator)
17368936 absence of correlation between mutations in specific JAG1 gene exons and clinical features in patients with leukoencephalopathy CADASIL-like phenotype
17359939 results reveal that Jagged1, which is regulated by hepatitis B virus X protein, may contribute to the development of hepatocellular carcinoma
17301032 Increased expression of Notch3, Jagged1, Hes1, and Hes6 gene transcripts were observed during differentiation of cultured human skeletal muscle cells.
16934875 Observational study of gene-disease association. (HuGE Navigator)
16823852 Jagged-1 induces cell growth inhibition and S phase cell cycle arrest in prostate cancer cells.
16791277 data indicate a role for JAGGED/Notch signaling in the process of thymic involution
16575836 83 novel mutations within the JAG1 gene are associated with Alagille syndrome.
16403414 Wild-type JAG1 is inhibitory for hepatocyte growth factor gene expression; mutant JAG1 reverses the inhibition
16307184 Data describe the immunohistochemical staining pattern of four Notch receptors (Notch1-4) and their ligands (Delta1 and Jagged1) in synovial tissues obtained from rheumatoid arthritis patients.
16013021 Identification of novel Jagged1 mutations in patients with Alagille syndrome.
15919944 observed that Jagged1 is preferentially upregulated in human cervical tumors and sustains tumor progression by HPV 16 oncogenes
15905075 Jagged1 and GDNF/Ret/GFRalpha1 interact and have a role in regulating ureteric budding and branching
15781650 Down-regulation of Notch-1, Delta-like-1, or Jagged-1 by RNA interference induces apoptosis and inhibits proliferation in multiple glioma cell lines.
15712272 12 new mutations are described: 5 frameshifts, 3 nonsense, 2 missense, and 2 splice site.
15466172 Dysregulation of JAGGED1 protein levels plays a role in prostate cancer progression and metastasis and suggest that JAGGED1 may be a useful marker in distinguishing indolent and aggressive prostate cancers.
15358557 structured in solution, as suggested by circular dichroism and NMR spectroscopy, and displays an EGF-like disulfide bond topology, as determined by disulfide mapping
15280477 upregulated in Papillomavirus-mediated cervical neoplasia and required for notch activation.
15258909 soluble form of Jagged1, when present in the cell culture medium, was sufficient to induce keratinocyte differentiation
15254769 Delta-1 and Jagged-1 have roles in growth suppression in two myeloid leukemia cell lines
14769803 induced an attenuation of cell motility which is accompanied by a decrease in actin stress fibers and an increase in adherence junctions and induces a NIH 3T3 cell tranformed phenotype mediated by FGF signaling.
14726396 Notch receptors 1&2 and their ligand Jagged1 are highly expressed in cultured and primary MM cells, suggesting Notch signaling is involved in the tight interactions between neoplastic plasma cells and their bone marrow microenvironment
12842995 Notch activation by JAG1 in the presence of alloantigen-presenting cells may therefore be a means of inducing specific regulatory T cells while preserving other T-cell functionality
12826675 Delta and Jagged undergo ADAM-mediated ectodomain processing followed by PS-mediated intramembrane proteolysis to release signaling fragments
12684674 suppresses the self-renewal capacity and long-term growth of two myeloblastic leukemia cell lines
12649809 Conditional mutation of this protein shows the developing heart is more sensitive than developing liver to JAG1 dosage.
12497640 Identification of novel Jagged1 mutations in patients with Alagille syndrome.
12496248 identification of C-terminal PDZ-ligand is essential for cellular transformation
12442286 Results of this study are consistent with the proposal that either haploinsufficiency for wild-type JAG1 and/or dominant negative effects produced by mutated JAG1 are responsible for the AGS phenotype.
12427653 Observational study of gene-disease association. (HuGE Navigator)
12370358 Activation of Notch-1 signaling by Jagged-1 induces monocyte-derived dendritic cell maturation in vitro.
12357247 experiments in vitro showed that Jagged1 signaling inhibited process outgrowth from primary human oligodendrocytes
12297837 JAG1 gene abnormality may be an aggravating factor in extrahepatic biliary atresia
12022040 Familial deafness, congenital heart defects, and posterior embryotoxon caused by cysteine substitution in the first epidermal-growth-factor-like domain of jagged 1.
11999354 inhibits proliferation of cd34+ macrophage progenitors
11964309 interaction with Notch1 on tumor cells dramatically induces proliferation and inhibition of apoptosis in vitro
11745040 a cell surface protein that functions in an ambryologically important signaling pathway

AA Sequence

MRSPRTRGRSGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDE      1 - 70
CDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWD     71 - 140
SSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHY    141 - 210
ACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPW    211 - 280
QCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGS    281 - 350
CKETSLGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP    351 - 420
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDE    421 - 490
CASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNC    491 - 560
SHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENI    561 - 630
NDCESNPCRNGGTCIDGVNSYKCICSDGWEGAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGK    631 - 700
TCHSRDSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVC    701 - 770
KEGWEGPICAQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN    771 - 840
GYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLLHKGHSE    841 - 910
CPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHIC    911 - 980
SELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIA    981 - 1050
AVAEVRVQRRPLKNRTDFLVPLLSSVLTVAWICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLN   1051 - 1120
QIKNPIEKHGANTVPIKDYENKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTP   1121 - 1190
TKHPNWTNKQDNRDLESAQSLNRMEYIV                                             1191 - 1218
//

Text Mined References (219)

PMID Year Title
27487663 2016 [CHANGES OF THE CONTENT OF DLL4 AND Jag-1 ANGIOGENESIS REGULATORS IN HUMAN DERMIS IN ONTOGENESIS].
26930648 2016 JAG1 Is Associated with Poor Survival through Inducing Metastasis in Lung Cancer.
26926447 2016 Increasing diagnostic accuracy to grade dysplasia in Barrett's esophagus using an immunohistochemical panel for CDX2, p120ctn, c-Myc and Jagged1.
26921446 2016 Stroma-induced Jagged1 expression drives PC3 prostate cancer cell migration; disparate effects of RIP-generated proteolytic fragments on cell behaviour and Notch signaling.
26779814 2016 Targeting of the pulmonary capillary vascular niche promotes lung alveolar repair and ameliorates fibrosis.
26760175 2016 JAG1 Loss-Of-Function Variations as a Novel Predisposing Event in the Pathogenesis of Congenital Thyroid Defects.
26721293 2016 Potential Involvement of Jagged1 in Metastatic Progression of Human Breast Carcinomas.
26679605 2016 miR-186 inhibits cell proliferation in multiple myeloma by repressing Jagged1.
26648562 2016 EGCG attenuates atherosclerosis through the Jagged-1/Notch pathway.
26646450 2015 Activation of an endothelial Notch1-Jagged1 circuit induces VCAM1 expression, an effect amplified by interleukin-1?.
26618708 2015 Alagille Syndrome Mimicking Biliary Atresia in Early Infancy.
26548814 2016 Jagged1 (JAG1): Structure, expression, and disease associations.
26546995 2016 The Vascular Notch Ligands Delta-Like Ligand 4 (DLL4) and Jagged1 (JAG1) Have Opposing Correlations with Microvascularization but a Uniform Prognostic Effect in Primary Glioblastoma: A Preliminary Study.
26406415 2015 Immunohistochemical expression of Notch1, Jagged1, NF-?B and MMP-9 in colorectal cancer patients and the relationship to clinicopathological parameters.
26387946 2015 Anti-estrogen Resistance in Human Breast Tumors Is Driven by JAG1-NOTCH4-Dependent Cancer Stem Cell Activity.
26350262 2016 PKC? Attenuates Jagged-1-Mediated Notch Signaling in ErbB-2-Positive Breast Cancer to Reverse Trastuzumab Resistance.
26341090 2016 Characterization of Notch Signalling Pathway Members in Normal Prostate, Prostatic Intraepithelial Neoplasia (PIN) and Prostatic Adenocarcinoma.
26339425 2015 JAGGED1 gene variations in Chinese twin sisters with Alagille syndrome.
26276215 2015 Fe65 negatively regulates Jagged1 signaling by decreasing Jagged1 protein stability through the E3 ligase Neuralized-like 1.
26076142 2015 JAG1 Mutation Spectrum and Origin in Chinese Children with Clinical Features of Alagille Syndrome.
25903338 2015 Human Cytomegalovirus Infection Dysregulates the Localization and Stability of NICD1 and Jag1 in Neural Progenitor Cells.
25842263 2015 Notch1 ligand signaling pathway activated in cervical cancer: poor prognosis with high-level JAG1/Notch1.
25825216 2015 Vehicular exhaust particles promote allergic airway inflammation through an aryl hydrocarbon receptor-notch signaling cascade.
25514871 2015 Epidermal growth factor receptor variant III renders glioma cancer cells less differentiated by JAGGED1.
25424769 2015 High Jagged1 expression is associated with poor outcome in primary glioblastoma.
25400810 2014 Relation of JAGGED 1 and collagen type 1 alpha 1 polymorphisms with bone mineral density in Chinese postmenopausal women.
25380486 2014 Endothelial cells provide a notch-dependent pro-tumoral niche for enhancing breast cancer survival, stemness and pro-metastatic properties.
25368251 2014 Protein and mRNA expression of notch pathway components in operable tumors of patients with laryngeal cancer.
25257302 2014 Notch signaling drives multiple myeloma induced osteoclastogenesis.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25176314 2014 Spatial localization of the JAG1/Notch1/osteopontin cascade modulates extrahepatic metastasis in hepatocellular carcinoma.
24907271 2014 ?-site amyloid precursor protein cleaving enzyme 1(BACE1) regulates Notch signaling by controlling the cleavage of Jagged 1 (Jag1) and Jagged 2 (Jag2) proteins.
24861552 2014 Genome-wide association study yields variants at 20p12.2 that associate with urinary bladder cancer.
24844362 2015 Jagged-1: a new promising factor associated with favorable prognosis in patients with acute myeloid leukemia.
24788939 2014 The complex interplay between ERK1/2, TGF?/Smad, and Jagged/Notch signaling pathways in the regulation of epithelial-mesenchymal transition in retinal pigment epithelium cells.
24748328 2014 Spectrum of JAG1 gene mutations in Polish patients with Alagille syndrome.
24722295 2014 Silencing of Jagged1 inhibits cell growth and invasion in colorectal cancer.
24708907 2014 NOTCH ligands JAG1 and JAG2 as critical pro-survival factors in childhood medulloblastoma.
24659709 2014 Epigenetic silencing of microRNA-199b-5p is associated with acquired chemoresistance via activation of JAG1-Notch1 signaling in ovarian cancer.
24604720 2014 Correlation of Sprouty1 and Jagged1 with aggressive prostate cancer cells with different sensitivities to androgen deprivation.
24573085 2014 Activation of Notch signaling by short-term treatment with Jagged-1 enhances store-operated Ca(2+) entry in human pulmonary arterial smooth muscle cells.
24239355 2013 Structural analysis uncovers lipid-binding properties of Notch ligands.
24138322 2014 Regulation of vascular smooth muscle cell phenotype in three-dimensional coculture system by Jagged1-selective Notch3 signaling.
23956173 2013 JAG1 mutation in a patient with deletion 22q11.2 syndrome and tetralogy of Fallot.
23934482 2013 NF-?B non-cell-autonomously regulates cancer stem cell populations in the basal-like breast cancer subtype.
23801938 2013 Alagille Syndrome: A New Missense Mutation Detected by Whole-Exome Sequencing in a Case Previously Found to Be Negative by DHPLC and MLPA.
23758219 2013 Overexpression of Jagged-1 and its intracellular domain in human mesenchymal stromal cells differentially affect the interaction with hematopoietic stem and progenitor cells.
23752887 2013 Renal involvement and the role of Notch signalling in Alagille syndrome.
23416080 2013 Jagged-1 juxtamembrane region: biochemical characterization and cleavage by ADAM17 (TACE) catalytic domain.
23379739 2013 Notch signaling is involved in neurogenic commitment of human periodontal ligament-derived mesenchymal stem cells.
23375636 2013 Endothelial cells promote the colorectal cancer stem cell phenotype through a soluble form of Jagged-1.
23339193 2013 Molecular basis for Jagged-1/Serrate ligand recognition by the Notch receptor.
23300864 2012 No evidence for a functional role of bi-directional Notch signaling during angiogenesis.
23157415 2013 Suppression of tongue squamous cell carcinoma growth by inhibition of Jagged1 in vitro and in vivo.
23086448 2012 The CD46-Jagged1 interaction is critical for human TH1 immunity.
22871495 2012 The putative tumor suppressor miR-524-5p directly targets Jagged-1 and Hes-1 in glioma.
22847978 2013 Surface-bound orientated Jagged-1 enhances osteogenic differentiation of human periodontal ligament-derived mesenchymal stem cells.
22618231 2012 Regulatory interplay between miR-21, JAG1 and 17beta-estradiol (E2) in breast cancer cells.
22526456 2012 Profiling immunohistochemical expression of NOTCH1-3, JAGGED1, cMET, and phospho-MAPK in 100 carcinomas of unknown primary.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22487239 2012 Functional analysis of the Notch ligand Jagged1 missense mutant proteins underlying Alagille syndrome.
22465068 2012 Flexibility of the PDZ-binding motif in the micelle-bound form of Jagged-1 cytoplasmic tail.
22405927 2012 Analysis of JAG1 gene variant in Chinese patients with Alagille syndrome.
22357466 2012 [Gene expression of Notch1 and Jagged1 in children with acute leukemia].
22348356 2012 Prognostic significance of Notch signalling molecules and their involvement in the invasiveness of endometrial carcinoma cells.
22296176 2012 Expression of vascular Notch ligands Delta-like 4 and Jagged-1 in glioblastoma.
22204979 2012 The role of endothelial cell-bound Jagged1 in Notch3-induced human coronary artery smooth muscle cell differentiation.
22174012 2013 JAG1 and COL1A1 polymorphisms and haplotypes in relation to bone mineral density variations in postmenopausal Mexican-Mestizo Women.
22080880 2012 Cancer stem cell and embryonic development-associated molecules contribute to prognostic significance in ovarian cancer.
22040217 2011 Novel and recurrent JAG1 mutations in patients with tetralogy of Fallot.
22020917 2012 Combination DLL4 with Jagged1-siRNA can enhance inhibition of the proliferation and invasiveness activity of human gastric carcinoma by Notch1/VEGF pathway.
21911304 2011 In vitro effects of stromal cells expressing different levels of Jagged-1 and Delta-1 on the growth of primitive and intermediate CD34(+) cell subsets from human cord blood.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21893051 2011 Mutational analysis of JAG1 gene in non-syndromic tetralogy of Fallot children.
21866461 2011 [Inhibitory effect and mechanism of (-)-epigallocatechin-3-gallate on HT29 and HCT-8 colorectal cancer cell lines and expression of HES1 and JAG1].
21820430 2011 The intracellular domain of Jagged-1 interacts with Notch1 intracellular domain and promotes its degradation through Fbw7 E3 ligase.
21810559 2011 Immunohistochemical localization of Notch signaling molecules in ameloblastomas.
21757656 2011 JAGGED1 signaling regulates hemangioma stem cell-to-pericyte/vascular smooth muscle cell differentiation.
21753153 2011 Targeting the notch ligand JAGGED1 in both tumor cells and stroma in ovarian cancer.
21752016 2012 JAG1 mutations are found in approximately one third of patients presenting with only one or two clinical features of Alagille syndrome.
21685392 2011 The miR-143/145 cluster is a novel transcriptional target of Jagged-1/Notch signaling in vascular smooth muscle cells.
21639801 Activated NOTCH2 is overexpressed in hepatoblastomas: an immunohistochemical study.
21637926 2011 Restored expression of the tumor suppressor gene RUNX3 reduces cancer stem cells in hepatocellular carcinoma by suppressing Jagged1-Notch signaling.
21602525 2011 Notch-3 and Notch-4 signaling rescue from apoptosis human B-ALL cells in contact with human bone marrow-derived mesenchymal stromal cells.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
21269460 2011 Initial characterization of the human central proteome.
21266409 2011 Jagged 1 regulates the restriction of Sox2 expression in the developing chicken inner ear: a mechanism for sensory organ specification.
21199807 2011 Plasminogen activator uPA is a direct transcriptional target of the JAG1-Notch receptor signaling pathway in breast cancer.
21145176 2011 Up-regulated expression of Notch1 and Jagged1 in human colon adenocarcinoma.
21103979 2011 Association analysis of Notch pathway signalling genes in diabetic nephropathy.
21062756 2011 High Jagged1 expression predicts poor outcome in clear cell renal cell carcinoma.
20953350 2010 Jagged1 expression regulated by Notch3 and Wnt/?-catenin signaling pathways in ovarian cancer.
20870935 2010 Autoamplification of Notch signaling in macrophages by TLR-induced and RBP-J-dependent induction of Jagged1.
20833210 2010 Jagged/Notch signalling is required for a subset of TGF?1 responses in human kidney epithelial cells.
20829885 2011 The Notch2-Jagged1 interaction mediates stem cell factor signaling in erythropoiesis.
20819128 2011 Activation of Notch signaling in human tongue carcinoma.
20819075 2010 Ectodomain shedding of the Notch ligand Jagged1 is mediated by ADAM17, but is not a lipid-raft-associated event.
20812035 2011 Activation of Notch signal pathway is associated with a poorer prognosis in acute myeloid leukemia.
20800871 2010 Immunohistochemical analysis of NOTCH1 and JAGGED1 expression in multiple myeloma and monoclonal gammopathy of undetermined significance.
20683201 2010 Analysis of gene mutations in children with cholestasis of undefined etiology.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20586101 The interaction of Jagged-1 cytoplasmic tail with afadin PDZ domain is local, folding-independent, and tuned by phosphorylation.
20580881 2010 Gene expression abnormalities and oligodendrocyte deficits in the internal capsule in schizophrenia.
20554499 2010 Squamous odontogenic tumor of the mandible: a case report demonstrating immunoexpression of Notch1, 3, 4, Jagged1 and Delta1.
20517681 2010 Association of high levels of Jagged-1 and Notch-1 expression with poor prognosis in head and neck cancer.
20437614 2010 Jagged1 (JAG1) mutations in patients with tetralogy of Fallot or pulmonic stenosis.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20096396 2010 Association of JAG1 with bone mineral density and osteoporotic fractures: a genome-wide association study and follow-up replication studies.
20052673 2010 Down-regulation of Notch-1 and Jagged-1 inhibits prostate cancer cell growth, migration and invasion, and induces apoptosis via inactivation of Akt, mTOR, and NF-kappaB signaling pathways.
20040020 2010 Detection of Notch signaling molecules in cemento-ossifying fibroma of the jaws.
20038814 2010 Mammalian target of rapamycin regulates murine and human cell differentiation through STAT3/p63/Jagged/Notch cascade.
19948535 2010 Comprehensive genotype-phenotype analysis in 230 patients with tetralogy of Fallot.
19935714 2010 Heterogeneity of Jagged1 expression in human and mouse intestinal tumors: implications for targeting Notch signaling.
19915977 2010 Cyclin D1 is a direct target of JAG1-mediated Notch signaling in breast cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19816565 2009 KSHV manipulates Notch signaling by DLL4 and JAG1 to alter cell cycle genes in lymphatic endothelia.
19780835 2009 The tetralogy of Fallot-associated G274D mutation impairs folding of the second epidermal growth factor repeat in Jagged-1.
19728763 2009 Expression of Notch1, Jagged1 and beta-catenin and their clinicopathological significance in hepatocellular carcinoma.
19682396 2009 Notch signaling is required for maintaining stem-cell features of neuroprogenitor cells derived from human embryonic stem cells.
19603167 2010 Aberrant expression of Notch signaling molecules in patients with immune thrombocytopenic purpura.
19586525 2009 Exon 6 of human JAG1 encodes a conserved structural unit.
19542446 2009 Notch ligands expressed by follicular dendritic cells protect germinal center B cells from apoptosis.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19430482 2009 Multiple loci associated with indices of renal function and chronic kidney disease.
19398721 2009 MicroRNA profiling identifies miR-34a and miR-21 and their target genes JAG1 and WNT1 in the coordinate regulation of dendritic cell differentiation.
19393188 2009 TNF induction of jagged-1 in endothelial cells is NFkappaB-dependent.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19181211 2008 Clonal analysis of hematopoiesis-supporting activity of human mesenchymal stem cells in association with Jagged1 expression and osteogenic potential.
19150886 2009 NOTCH3 expression is induced in mural cells through an autoregulatory loop that requires endothelial-expressed JAGGED1.
19150223 2009 Human umbilical cord epithelial cells express Notch ligands Delta1 and Jagged1.
18784255 2008 Novel cross-talk between three cardiovascular regulators: thrombin cleavage fragment of Jagged1 induces fibroblast growth factor 1 expression and release.
18660822 2008 A conserved face of the Jagged/Serrate DSL domain is involved in Notch trans-activation and cis-inhibition.
18632624 2008 Jagged-1 and Notch3 juxtacrine loop regulates ovarian tumor growth and adhesion.
18593716 2008 NOTCH1 mutations in individuals with left ventricular outflow tract malformations reduce ligand-induced signaling.
18563556 2009 Expression profiling of familial breast cancers demonstrates higher expression of FGFR2 in BRCA2-associated tumors.
18354251 2008 Notch1, Jagged1, and HES5 are abundantly expressed in osteoarthritis.
18266235 2008 Absence of NOTCH2 and Hey2 mutations in a familial Alagille syndrome case with a novel frameshift mutation in JAG1.
18192230 2008 Notch signaling through Jagged-1 is necessary to initiate chondrogenesis in human bone marrow stromal cells but must be switched off to complete chondrogenesis.
18079963 2008 Suppression of renal cell carcinoma growth by inhibition of Notch signaling in vitro and in vivo.
18060036 2007 IL-6 triggers malignant features in mammospheres from human ductal breast carcinoma and normal mammary gland.
17990101 2008 JAG1 expression is associated with a basal phenotype and recurrence in lymph node-negative breast cancer.
17984306 2007 Jagged1-mediated Notch activation induces epithelial-to-mesenchymal transition through Slug-induced repression of E-cadherin.
17822320 2007 A study on Notch signaling in human breast cancer.
17720887 2007 Biological function of mutant forms of JAGGED1 proteins in Alagille syndrome: inhibitory effect on Notch signaling.
17661408 2007 Increasing the mutation rate for Jagged1 mutations in patients with Alagille syndrome.
17507991 2007 High-level JAG1 mRNA and protein predict poor outcome in breast cancer.
17368936 2007 Putative role of specific JAG1 gene exons in modulating clinical features in patients with leukoencephalopathy.
17359939 2007 Expression of Jagged1 and its association with hepatitis B virus X protein in hepatocellular carcinoma.
17301032 2007 Impaired expression of Notch signaling genes in aged human skeletal muscle.
16934875 2006 Linkage disequilibrium screening for multiple sclerosis implicates JAG1 and POU2AF1 as susceptibility genes in Europeans.
16823852 2006 Down-regulation of Jagged-1 induces cell growth inhibition and S phase arrest in prostate cancer cells.
16791277 2006 Expression of JAGGED1 in T-lymphocytes results in thymic involution by inducing apoptosis of thymic stromal epithelial cells.
16575836 2006 Jagged1 (JAG1) mutations in Alagille syndrome: increasing the mutation detection rate.
16403414 2006 Human Jagged 1 mutants cause liver defect in Alagille syndrome by overexpression of hepatocyte growth factor.
16307184 2005 Immunohistological localization of Notch receptors and their ligands Delta and Jagged in synovial tissues of rheumatoid arthritis.
16013021 Renal failure and hypertension in Alagille syndrome with a novel JAG1 mutation.
15919944 2005 Complementation of human papillomavirus type 16 E6 and E7 by Jagged1-specific Notch1-phosphatidylinositol 3-kinase signaling involves pleiotropic oncogenic functions independent of CBF1;Su(H);Lag-1 activation.
15905075 2005 Crosstalk between Jagged1 and GDNF/Ret/GFRalpha1 signalling regulates ureteric budding and branching.
15781650 2005 Expression of Notch-1 and its ligands, Delta-like-1 and Jagged-1, is critical for glioma cell survival and proliferation.
15712272 2005 Twelve novel JAG1 gene mutations in Polish Alagille syndrome patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466172 2004 JAGGED1 expression is associated with prostate cancer metastasis and recurrence.
15358557 2004 Exon 6 of human Jagged-1 encodes an autonomously folding unit.
15280477 2004 Papillomavirus-mediated neoplastic progression is associated with reciprocal changes in JAGGED1 and manic fringe expression linked to notch activation.
15258909 2004 Soluble form of Jagged1: unique product of epithelial keratinocytes and a regulator of keratinocyte differentiation.
15254769 2004 Cellular analysis of growth suppression induced by the Notch ligands, Delta-1 and Jagged-1 in two myeloid leukemia cell lines.
14769803 2004 The non-transmembrane form of Delta1, but not of Jagged1, induces normal migratory behavior accompanied by fibroblast growth factor receptor 1-dependent transformation.
14726396 2004 Jagged1-induced Notch signaling drives proliferation of multiple myeloma cells.
14714274 2004 Pathogenic mutations associated with cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy differently affect Jagged1 binding and Notch3 activity via the RBP/JK signaling Pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12842995 2003 Overexpression of the Notch ligand, Jagged-1, induces alloantigen-specific human regulatory T cells.
12826675 2003 The Notch ligands, Jagged and Delta, are sequentially processed by alpha-secretase and presenilin/gamma-secretase and release signaling fragments.
12684674 2003 Notch ligands, Delta-1 and Delta-4 suppress the self-renewal capacity and long-term growth of two myeloblastic leukemia cell lines.
12649809 2003 Conditional JAG1 mutation shows the developing heart is more sensitive than developing liver to JAG1 dosage.
12497640 2003 Identification of 36 novel Jagged1 (JAG1) mutations in patients with Alagille syndrome.
12496248 2003 The C-terminal PDZ-ligand of JAGGED1 is essential for cellular transformation.
12482954 2002 A CADASIL-mutated Notch 3 receptor exhibits impaired intracellular trafficking and maturation but normal ligand-induced signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12442286 2002 DHPLC mutation analysis of Jagged1 (JAG1) reveals six novel mutations in Australian alagille syndrome patients.
12427653 2002 Analysis of cardiovascular phenotype and genotype-phenotype correlation in individuals with a JAG1 mutation and/or Alagille syndrome.
12370358 2002 The Notch ligand Jagged-1 is able to induce maturation of monocyte-derived human dendritic cells.
12357247 2002 Multiple sclerosis: re-expression of a developmental pathway that restricts oligodendrocyte maturation.
12297837 2002 The significance of human jagged 1 mutations detected in severe cases of extrahepatic biliary atresia.
12107827 2002 Jagged-1 mediated activation of notch signaling induces complete maturation of human keratinocytes through NF-kappaB and PPARgamma.
12036964 2002 Notch ligands are substrates for protein O-fucosyltransferase-1 and Fringe.
12022040 2002 Familial deafness, congenital heart defects, and posterior embryotoxon caused by cysteine substitution in the first epidermal-growth-factor-like domain of jagged 1.
11964309 2002 Activated Notch1 signaling promotes tumor cell proliferation and survival in Hodgkin and anaplastic large cell lymphoma.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11745040 2001 Alagille syndrome and the Jagged1 gene.
11549580 2001 Members of the Jagged/Notch gene families are expressed in injured arteries and regulate cell phenotype via alterations in cell matrix and cell-cell interaction.
11427524 2001 Soluble Jagged 1 represses the function of its transmembrane form to induce the formation of the Src-dependent chord-like phenotype.
11180599 2001 Mutation analysis of Jagged1 (JAG1) in Alagille syndrome patients.
11157803 2001 Defective intracellular transport and processing of JAG1 missense mutations in Alagille syndrome.
11152664 2001 Familial Tetralogy of Fallot caused by mutation in the jagged1 gene.
11139247 2001 Fifteen novel mutations in the JAGGED1 gene of patients with Alagille syndrome.
11067884 2000 The notch ligand jagged-1 represents a novel growth factor of human hematopoietic stem cells.
11058898 2000 Jagged1 (JAG1) mutation detection in an Australian Alagille syndrome population.
11006133 2000 Physical interaction of Delta1, Jagged1, and Jagged2 with Notch1 and Notch3 receptors.
10978356 2000 JAGGED1 expression in human embryos: correlation with the Alagille syndrome phenotype.
10958687 2000 Binding of Delta1, Jagged1, and Jagged2 to Notch2 rapidly induces cleavage, nuclear translocation, and hyperphosphorylation of Notch2.
10679295 2000 A non-transmembrane form of Jagged-1 regulates the formation of matrix-dependent chord-like structures.
10551863 1999 Mouse jagged1 physically interacts with notch2 and other notch receptors. Assessment by quantitative methods.
10533065 1999 Jagged-1 mutation analysis in Italian Alagille syndrome patients.
10329626 1999 Rel/NF-kappaB can trigger the Notch signaling pathway by inducing the expression of Jagged1, a ligand for Notch receptors.
10220506 1999 Mutations in JAGGED1 gene are predominantly sporadic in Alagille syndrome.
10079256 1999 Human ligands of the Notch receptor.
9707552 1998 PDZ-domain-mediated interaction of the Eph-related receptor tyrosine kinase EphB3 and the ras-binding protein AF6 depends on the kinase activity of the receptor.
9585603 1998 Spectrum and frequency of jagged1 (JAG1) mutations in Alagille syndrome patients and their families.
9462510 1998 The human homolog of rat Jagged1 expressed by marrow stroma inhibits differentiation of 32D cells through interaction with Notch1.
9268641 1997 Identification and cloning of the human homolog (JAG1) of the rat Jagged1 gene from the Alagille syndrome critical region at 20p12.
9207788 1997 Alagille syndrome is caused by mutations in human Jagged1, which encodes a ligand for Notch1.
9207787 1997 Mutations in the human Jagged1 gene are responsible for Alagille syndrome.
8955070 1996 An antisense oligonucleotide to the notch ligand jagged enhances fibroblast growth factor-induced angiogenesis in vitro.
8923452 1996 Expression patterns of Jagged, Delta1, Notch1, Notch2, and Notch3 genes identify ligand-receptor pairs that may function in neural development.
8635876 1996 Isolation of genes differentially expressed in human primary myoblasts and embryonal rhabdomyosarcoma.
7697721 1995 Jagged: a mammalian ligand that activates Notch1.