Property Summary

NCBI Gene PubMed Count 26
PubMed Score 12.18
PubTator Score 9.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
ependymoma 1.400 9.6e-03
psoriasis -1.400 1.6e-10
osteosarcoma -2.469 1.7e-07
group 3 medulloblastoma 1.800 2.1e-02
non-small cell lung cancer -1.519 2.7e-13
intraductal papillary-mucinous carcinoma... -1.100 4.1e-02
intraductal papillary-mucinous neoplasm ... -2.000 5.7e-03
active Crohn's disease 1.035 3.3e-02
pancreatic cancer -1.100 6.1e-05
breast carcinoma -1.100 1.8e-05
aldosterone-producing adenoma -1.211 2.2e-02
subependymal giant cell astrocytoma -1.251 7.8e-03
lung adenocarcinoma -1.800 2.0e-14
spina bifida -1.182 3.4e-02
ductal carcinoma in situ -1.400 4.1e-04
invasive ductal carcinoma -1.400 1.6e-03
ulcerative colitis 1.100 7.4e-04
ovarian cancer -1.400 3.8e-07
Breast cancer -1.100 3.2e-04

Gene RIF (12)

PMID Text
26151225 JADE1S protein localized to centrosomes in interphase and mitotic cells, and to the midbody during cytokinesis.
25100726 Casein kinase 1 alpha specifically phosphorylates Jade-1 at an unprimed SLS phosphorylation site.
24739512 Increase in the number of cells with cytoplasmic JADE1S correlated with activation of tubular cell proliferation and inversely correlated with the number of cells with nuclear JADE1S, supporting role of HBO1-JADE1 shuttling during organ regeneration.
24097061 lncRNA-JADE is a key functional link that connects the DDR to histone H4 acetylation, and that dysregulation of lncRNA-JADE may contribute to breast tumorigenesis.
23824745 Reduced Jade-1 expression is associated with clear-cell renal cell carcinomas.
22654112 The ciliary protein nephrocystin-4 translocates the canonical Wnt regulator Jade-1 to the nucleus to negatively regulate beta-catenin signaling.
22516360 RCC with a low expression of Jade-1 is associated with a poor outcome and decreased survival
18806787 The pVHL tumour suppressor and the Wnt tumorigenesis pathway are therefore directly linked through Jade-1.
18684714 Jade-1/1L are crucial co-factors for HBO1-mediated histone H4 acetylation
16046545 Jade-1 may suppress renal cancer cell growth in part by increasing apoptosis.
15502158 Jade-1 is a novel candidate transcriptional co-activator associated with HAT activity and may play a key role in the pathogenesis of renal cancer and von Hippel-Lindau disease
12169691 Jade-1 protein is a novel candidate regulatory factor in Von Hippel Lindau-mediated renal tumor suppression

AA Sequence

MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYY      1 - 70
VLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCR     71 - 140
YDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQ    141 - 210
SPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHV    211 - 280
SCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMK    281 - 350
TILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKL    351 - 420
QQLEDEFYTFVNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQ    421 - 490
LFTHLRQDLERVRNLTYMVTRREKIKRSVCKVQEQIFNLYTKLLEQERVSGVPSSCSSSSLENMLLFNSP    491 - 560
SVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPLQNSPGSEGKTLLKQPDLCGRREGMVVPESF    561 - 630
LGLEKTFAEARLISAQQKNGVVMPDHGKRRDNRFHCDLIKGDLKDKSFKQSHKPLRSTDVSQRHLDNTRA    631 - 700
ATSPGVGQSAPGTRKEIVPKCNGSLIKVNYNQTAVKVPTTPASPVKNWGGFRIPKKGERQQQGEAHDGAC    701 - 770
HQHSDYPYLGLGRVPAKERAKSKLKSDNENDGYVPDVEMSDSESEASEKKCIHTSSTISRRTDIIRRSIL    771 - 840
AS                                                                        841 - 842
//

Text Mined References (32)

PMID Year Title
26151225 2015 The novel function of JADE1S in cytokinesis of epithelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
25100726 2014 Casein kinase 1 ? phosphorylates the Wnt regulator Jade-1 and modulates its activity.
24739512 2014 Cell cycle-dependent chromatin shuttling of HBO1-JADE1 histone acetyl transferase (HAT) complex.
24097061 2013 A novel non-coding RNA lncRNA-JADE connects DNA damage signalling to histone H4 acetylation.
23824745 2013 Candidate tumor suppressor and pVHL partner Jade-1 binds and inhibits AKT in renal cell carcinoma.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23001567 2012 Polycystin-1 regulates the stability and ubiquitination of transcription factor Jade-1.
22654112 2012 The ciliary protein nephrocystin-4 translocates the canonical Wnt regulator Jade-1 to the nucleus to negatively regulate ?-catenin signaling.
22516360 2012 Expression and clinical significance of von Hippel-Lindau downstream genes: Jade-1 and ?-catenin related to renal cell carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18806787 2008 Jade-1 inhibits Wnt signalling by ubiquitylating beta-catenin and mediates Wnt pathway inhibition by pVHL.
18684714 2008 Role of Jade-1 in the histone acetyltransferase (HAT) HBO1 complex.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16387653 2006 ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16046545 2005 Jade-1, a candidate renal tumor suppressor that promotes apoptosis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15502158 2004 von Hippel-Lindau partner Jade-1 is a transcriptional co-activator associated with histone acetyltransferase activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612400 2003 Identification of Jade1, a gene encoding a PHD zinc finger protein, in a gene trap mutagenesis screen for genes involved in anteroposterior axis development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12169691 2002 The von Hippel-Lindau tumor suppressor stabilizes novel plant homeodomain protein Jade-1.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.