Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Hypothyroidism 89

Synonym

Accession J3KSC0
Symbols C18orf64

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVPAPPFLGVLENPVPQWDLSILGSIRIRVSHTEVQGSGSSRSPEALRKESLEVEWTLVLLAIPPRIQPS      1 - 70
QQDGGPPKCCDLLRAALLGRHCPLCVPAGEVFSQKRDNEQDRSEFIGQTLKLLVKRNVSLELSCR          71 - 135
//

Text Mined References (4)

PMID Year Title
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16177791 2005 DNA sequence and analysis of human chromosome 18.