Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count
Hypothyroidism 89

Synonym

Accession J3KSC0
Symbols C18orf64

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVPAPPFLGVLENPVPQWDLSILGSIRIRVSHTEVQGSGSSRSPEALRKESLEVEWTLVLLAIPPRIQPS      1 - 70
QQDGGPPKCCDLLRAALLGRHCPLCVPAGEVFSQKRDNEQDRSEFIGQTLKLLVKRNVSLELSCR          71 - 135
//

Text Mined References (4)

PMID Year Title
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16177791 2005 DNA sequence and analysis of human chromosome 18.