Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.10
PubTator Score 1282.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis -1.300 2.2e-03
group 3 medulloblastoma 2.100 4.1e-05
astrocytoma 1.100 3.7e-02
glioblastoma 2.100 3.5e-03
atypical teratoid / rhabdoid tumor 1.300 7.9e-04
medulloblastoma, large-cell 1.600 1.3e-04
Amyotrophic Lateral Sclerosis 1.281 1.6e-06
intraductal papillary-mucinous adenoma (... 1.900 4.4e-04
intraductal papillary-mucinous carcinoma... 1.800 4.1e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.6e-02
X-linked cerebral adrenoleukodystrophy 1.400 2.7e-02
lung cancer 1.200 7.2e-04
breast carcinoma 1.300 6.0e-03
diabetes mellitus -1.100 1.8e-02
cystic fibrosis -1.300 1.2e-03
Pick disease -1.100 6.2e-04
progressive supranuclear palsy -1.300 1.4e-02
invasive ductal carcinoma 1.100 2.5e-02
ovarian cancer 2.700 1.4e-05
pituitary cancer -1.300 2.8e-05
dermatomyositis 1.300 7.6e-04

Gene RIF (7)

PMID Text
25619834 Our study identifies KLHL39 as a negative regulator of Cul3-KLHL20 ubiquitin ligase and reveals a role of KLHL39-mediated PML and DAPK stabilization in colon cancer metastasis.
24210102 This study provided evidence that miRNA-548an is involved in the regulation of NS1ABP.
23825951 NS1-BP-hnRNPK complex is a key mediator of influenza A virus gene expression.
22190034 HIV-1 Gag is identified to have a physical interaction with influenza virus NS1A binding protein (IVNS1ABP; NS1BP) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17996313 These findings further support the distinct roles of alpha-enolase and its MBP-1 variant in maintaining cell homeostasis. Moreover, these data suggest a novel function for NS1-BP in the control of cell proliferation.

AA Sequence

MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGI      1 - 70
SHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYRNF     71 - 140
ASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEVMLEDNVCLPSNGKLYTKVINWVQRSIWENG    141 - 210
DSLEELMEEVQTLYYSADHKLLDGNLLDGQAEVFGSDDDHIQFVQKKPPRENGHKQISSSSTGCLSSPNA    211 - 280
TVQSPKHEWKIVASEKTSNNTYLCLAVLDGIFCVIFLHGRNSPQSSPTSTPKLSKSLSFEMQQDELIEKP    281 - 350
MSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVV    351 - 420
GGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLKNCDVFDPVTK    421 - 490
LWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLNGK    491 - 560
LFVCGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGIATVGNTIYAVGGFDGNEFLNTVEVYNLES    561 - 630
NEWSPYTKIFQF                                                              631 - 642
//

Text Mined References (24)

PMID Year Title
25619834 2015 KLHL39 suppresses colon cancer metastasis by blocking KLHL20-mediated PML and DAPK ubiquitination.
24210102 2013 Expression of non-structural-1A binding protein in lung epithelial cells is modulated by miRNA-548an on exposure to influenza A virus.
23825951 2013 Cellular RNA binding proteins NS1-BP and hnRNP K regulate influenza A virus RNA splicing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17996313 2007 The kelch protein NS1-BP interacts with alpha-enolase/MBP-1 and is involved in c-Myc gene transcriptional control.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16582008 2006 The aryl hydrocarbon receptor signaling pathway is modified through interactions with a Kelch protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9847309 1999 A novel heterogeneous nuclear ribonucleoprotein-like protein interacts with NS1 of the minute virus of mice.
9696811 1998 NS1-Binding protein (NS1-BP): a novel human protein that interacts with the influenza A virus nonstructural NS1 protein is relocalized in the nuclei of infected cells.