Property Summary

NCBI Gene PubMed Count 59
PubMed Score 970.75
PubTator Score 199.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -3.100 1.9e-02
psoriasis 2.300 4.7e-10
cutaneous lupus erythematosus 1.600 7.0e-03
medulloblastoma, large-cell 1.400 5.2e-05
non-small cell lung cancer 2.276 1.3e-09
interstitial cystitis -2.400 2.0e-04
cystic fibrosis 1.100 2.3e-03
adult high grade glioma 1.200 1.2e-02
spina bifida -2.127 4.0e-02
ovarian cancer 1.700 1.1e-11

Gene RIF (35)

PMID Text
24515279 Together, these results suggest that GR modulates involucrin expression of keratinocytes by regulating the intracellular signaling network in a ligand-independent manner.
24252747 over-expression of Nnat was evident along with involucrin and cytokeratin1 expression
23599428 KLF4 is part of a multiprotein complex that interacts that the hINV promoter distal regulatory region to drive differentiation-dependent hINV gene expression in epidermis.
23283814 involucrin is up-regulated in psoriatic keratinocytes
22742591 Compared with the control, the level of expression of the IVL gene in NCTC 2544 cells was increased after 8 h of treatment with hyaluronic acid or Plantaricin A preparations.
22333115 The authors found that HPV 16 E6 but not E7 repressed IVL promoter activity in proliferating human foreskin keratinocyte cells.
22197495 Therefore, together with trichohyalin, the cross-linking due to involucrin is also responsible for the mechanical resistance of the corneous trabeculae present among the empty spaces of the medulla of the human hair.
20208004 expression of the epidermal differentiation complex genes filaggrin and involucrin was strongly decreased directly by IL-13.
19701759 higher expression in the fetal skin than in adult skin
19601998 Observational study of gene-disease association. (HuGE Navigator)
19515043 Infection by HPV may alter the differentiation status of the epidermis, leading to earlier involucrin expression
18637039 RT-PCR and western blot analysis revealed a delay in the expression of the differentiation markers K1, K10 and involucrin in HaCaT cells compared with normal human keratinocytes
18259765 siRNA for PRKD1 resulted in reduction of mRNA levels of PKD1, altered cell phenotype and promotion of keratinocyte differentiation, demonstrated by increased expression of involucrin and keratin 10 mRNAs
18166499 The expression of loricrin and involucrin in invovled and uninvolved skin of patients with atopic dermatitis is reported.
18077140 PPAR gamma regulates involucrin expression by controlling the AP-1 signal and p38 activation in 1 alpha,25(OH)2D3-induced keratinocyte differentiation.
17968567 The expression of beta1-integrin was found to be significantly reduced in photoaged skin and ratios of the expressions of involucrin to beta1-integrin were increased 2.6-fold only in elderly subjects.
17943181 These findings indicate that PKCdelta activity for activation of involucrin promoter requires Y(311) and a second tyrosine residue; however, any one of the several tyrosine residues can serve in the secondary role.
17882273 a large multiprotein complex, which includes Fra-1, p300, P/CAF, junD, junB, and Sp1 acts at the AP1-5 site to produce a synergistic increase in hINV gene expression
17662274 BAG-1L also potentiated transactivation of known vitamin-D-responsive gene promoters, osteocalcin and 24-hydroxylase, and enhanced VDR-dependent transcription and protein expression of the keratinocyte differentiation marker, involucrin.
17330131 There is a major role for STAT5a in the differentiation of keratinocytes, where it contributes to involucrin expression by activating the PPARgamma signal.
17205062 Pyk2 regulation is associated with increased expression of Fra-1 and JunD, activator protein-1 transcription factors known to be required for involucrin expression.
16982614 involucrin gene expression inhibition by apigenin is associated with a specific reduction in phosphorylation of protein kinase Cdelta Tyr311
16374477 AP1, Sp1, and C/EBP transcription factors are required for appropriate differentiation-dependent involucrin expression.
16140218 Involucrin expression of keratinocytes is suppressed by roxithromycin through direct inhibition of AP-1 and indirect inhibition of NF-kappaB.
15805105 Beta ig-h3 induces keratinocyte differentiation via modulation of involucrin and transglutaminase expression through the integrin alpha3beta1 and the phosphatidylinositol 3-kinase/Akt signaling pathway
15586248 YY-1 and c-Jun transcription factors participate in the repression of the human involucrin promoter.
15304097 cholesterol depletion alters involucrin gene expression through activation of p38alpha/beta.
15191537 cascade regulates activator protein one, Sp1, and CCATT/enhancer-binding protein transcription factor DNA binding to two discrete involucrin promoter regions, the distal- and proximal-regulatory regions, to regulate involucrin gene expression.
15044435 human involucrin promoter activity is regulated by green tea polyphenol and curcumin via opposing effects on CCAAT/enhancer-binding protein function
15037572 role for AP1 transcription factors in the regulation of human corneal epithelial cell involucrin gene expression.
12810719 p38 delta is the major p38 isoform driving suprabasal hINV gene expression
12445200 the AP-1 site and the vitamin D response element in the involucrin promoter play important roles in mediating the action of 1,25-dihydroxyvitamin D3 on involucrin expression
12126624 transactivation of involucrin by lens epithelium-derived growth factor (LEDGF)
11850802 involucrin gene contains distinct regulatory elements that regulate expression during epidermal differentiation
9159190 Transcriptional activation of the involucrin gene by calcium in keratinocytes.

AA Sequence

MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGL      1 - 70
PEQECEQQQKEPQEQELQQQHWEQHEEYQKAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVK     71 - 140
RDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQE    141 - 210
GQLELPEQQEGQLELPEQQEGQLELPQQQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQM    211 - 280
GQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQE    281 - 350
GQLEHLEHQEGQLGLPEQQVLQLKQLEKQQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQLEQQERQV    351 - 420
EHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQL    421 - 490
ELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPGQVQDIQPALP    491 - 560
TKGEVLLPVEHQQQKQEVQWPPKHK                                                 561 - 585
//

Text Mined References (61)

PMID Year Title
24515279 2014 Glucocorticoid receptor enhances involucrin expression of keratinocyte in a ligand-independent manner.
24252747 2014 Neuronatin is related to keratinocyte differentiation by up-regulating involucrin.
23599428 2013 Protein kinase C ? increases Kruppel-like factor 4 protein, which drives involucrin gene transcription in differentiating keratinocytes.
23283814 2013 Regulation of involucrin in psoriatic epidermal keratinocytes: the roles of ERK1/2 and GSK-3?.
22742591 2012 The antimicrobial peptide pheromone Plantaricin A increases antioxidant defenses of human keratinocytes and modulates the expression of filaggrin, involucrin, ?-defensin 2 and tumor necrosis factor-? genes.
22333115 2012 Effects of human papillomavirus (HPV) type 16 oncoproteins on the expression of involucrin in human keratinocytes.
22197495 2012 Ultrastructural immunolocalization of involucrin in the medulla and inner root sheath of the human hair.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20208004 2010 Coordinate interaction between IL-13 and epithelial differentiation cluster genes in eosinophilic esophagitis.
19701759 2010 Comparison between human fetal and adult skin.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
19515043 2009 Comparative analysis of the expression of cytokeratins (1, 10, 14, 16, 4), involucrin, filaggrin and e-cadherin in plane warts and epidermodysplasia verruciformis plane wart-type lesions.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18637039 2009 Effects of extracellular calcium on the growth-differentiation switch in immortalized keratinocyte HaCaT cells compared with normal human keratinocytes.
18259765 2008 Knockdown of PKD1 in normal human epidermal keratinocytes increases mRNA expression of keratin 10 and involucrin: early markers of keratinocyte differentiation.
18166499 2008 Loricrin and involucrin expression is down-regulated by Th2 cytokines through STAT-6.
18077140 2008 PPAR gamma is an important transcription factor in 1 alpha,25-dihydroxyvitamin D3-induced involucrin expression.
17968567 2008 Photoaging-associated changes in epidermal proliferative cell fractions in vivo.
17943181 2008 Multiple PKCdelta tyrosine residues are required for PKCdelta-dependent activation of involucrin expression--a key role of PKCdelta-Y311.
17882273 2008 Synergistic activation of human involucrin gene expression by Fra-1 and p300--evidence for the presence of a multiprotein complex.
17662274 2007 Subcellular localisation of BAG-1 and its regulation of vitamin D receptor-mediated transactivation and involucrin expression in oral keratinocytes: implications for oral carcinogenesis.
17330131 2007 STAT5a/PPARgamma pathway regulates involucrin expression in keratinocyte differentiation.
17205062 2007 The role of proline-rich protein tyrosine kinase 2 in differentiation-dependent signaling in human epidermal keratinocytes.
16982614 2006 Apigenin inhibition of involucrin gene expression is associated with a specific reduction in phosphorylation of protein kinase Cdelta Tyr311.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16639001 2006 Expression and regulation of cornified envelope proteins in human corneal epithelium.
16374477 2006 The distal and proximal regulatory regions of the involucrin gene promoter have distinct functions and are required for in vivo involucrin expression.
16140218 2005 Roxithromycin suppresses involucrin expression by modulation of activator protein-1 and nuclear factor-kappaB activities of keratinocytes.
15805105 2005 Beta ig-h3 induces keratinocyte differentiation via modulation of involucrin and transglutaminase expression through the integrin alpha3beta1 and the phosphatidylinositol 3-kinase/Akt signaling pathway.
15586248 2005 YY-1 and c-Jun transcription factors participate in the repression of the human involucrin promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304097 2004 Cholesterol depletion upregulates involucrin expression in epidermal keratinocytes through activation of p38.
15191537 2004 Regulation of involucrin gene expression.
15147942 2004 Identification and characterization of a novel component of the cornified envelope, cornifelin.
15044435 2004 Green tea polyphenol and curcumin inversely regulate human involucrin promoter activity via opposing effects on CCAAT/enhancer-binding protein function.
15037572 2004 Regulation of involucrin expression in normal human corneal epithelial cells: a role for activator protein one.
12810719 2003 A regulatory role for p38 delta MAPK in keratinocyte differentiation. Evidence for p38 delta-ERK1/2 complex formation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445200 2002 The vitamin D response element of the involucrin gene mediates its regulation by 1,25-dihydroxyvitamin D3.
12397374 2002 Crucial role of fibroblasts in regulating epidermal morphogenesis.
12126624 2002 Transactivation of involucrin, a marker of differentiation in keratinocytes, by lens epithelium-derived growth factor (LEDGF).
11850802 2002 The human involucrin gene contains spatially distinct regulatory elements that regulate expression during early versus late epidermal differentiation.
11443109 2001 Transglutaminase 5 cross-links loricrin, involucrin, and small proline-rich proteins in vitro.
10908733 2000 Small proline-rich protein 1 is the major component of the cell envelope of normal human oral keratinocytes.
9804813 1998 The distal regulatory region of the human involucrin promoter is required for expression in epidermis.
9651377 1998 Ceramides are bound to structural proteins of the human foreskin epidermal cornified cell envelope.
9512462 1998 Characterization of human involucrin promoter distal regulatory region transcriptional activator elements-a role for Sp1 and AP1 binding sites.
9159190 1996 Regulation of involucrin gene expression by calcium in normal human keratinocytes.
9115270 1997 S100A11, S100A10, annexin I, desmosomal proteins, small proline-rich proteins, plasminogen activator inhibitor-2, and involucrin are components of the cornified envelope of cultured human epidermal keratinocytes.
8999895 1997 Direct evidence that involucrin is a major early isopeptide cross-linked component of the keratinocyte cornified cell envelope.
8554386 1995 Repression of involucrin gene expression by transcriptional enhancer factor 1 (TEF-1).
8550612 1996 Transcriptional analysis of the 5'-noncoding region of the human involucrin gene.
8380829 1993 Analysis of the 5'-upstream promoter region of human involucrin gene: activation by 12-O-tetradecanoylphorbol-13-acetate.
8276421 1993 Physical mapping of a functional cluster of epidermal differentiation genes on chromosome 1q21.
7759510 1995 Fos-related antigen (Fra-1), junB, and junD activate human involucrin promoter transcription by binding to proximal and distal AP1 sites to mediate phorbol ester effects on promoter activity.
2985954 1985 Repeat arrays in cellular DNA related to the Epstein-Barr virus IR3 repeat.
2873896 1986 Structure and evolution of the human involucrin gene.
2461365 1988 The glutamine residues reactive in transglutaminase-catalyzed cross-linking of involucrin.
1601889 1992 Biophysical characterization of involucrin reveals a molecule ideally suited to function as an intermolecular cross-bridge of the keratinocyte cornified envelope.
42494 1979 Presence in human epidermal cells of a soluble protein precursor of the cross-linked envelope: activation of the cross-linking by calcium ions.