Property Summary

NCBI Gene PubMed Count 32
PubMed Score 327.94
PubTator Score 28.01

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.800 1.7e-04
osteosarcoma -1.269 1.0e-04
atypical teratoid / rhabdoid tumor -1.100 2.2e-04
glioblastoma -1.200 4.9e-06
medulloblastoma -1.400 1.4e-03
medulloblastoma, large-cell -2.000 8.1e-07
acute quadriplegic myopathy 1.011 7.8e-07
ovarian cancer -1.900 5.3e-08
dermatomyositis 1.400 2.7e-04

Gene RIF (10)

PMID Text
26633357 ITSN2L interacts with RABEP1 and stimulates its degradation in regulation of endocytosis.
23936226 ITSN1 and ITSN2 bind similar proline-rich ligands but are differentially recognized by SH2 domain-containing proteins.
23274495 The sequence and structural alignment of ITSN-2L C2 domain with other members of C2 domain protein family indicate its vital cellular roles in membrane trafficking, the generation of lipid-second messengers and activation of GTPases. Moreover, our data show the possible roles of ITSN-2L C2 domain in regulating the activity of Cdc42.
22449706 The ITSN2 interacts with Eps8 and stimulates the degradation of Eps8 proteins.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19622753 ITSN-2L, a guanine nucleotide exchange factor for Cdc42, regulates different steps of caveola endocytosis in ECs by controlling the temporal and spatial actin polymerization and remodeling sub-adjacent to the plasma membrane.
19460752 Knockdown of intersectin 2 (ITSN2; SH3P18) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
17696407 We show that the PPLP motif of K15 protein selectively binds the SH3-C domain of an endocytic adaptor protein, Intersectin 2 (ITSN2).
17390067 ITSN2C may be specifically expressed in neurons hinting to a physiologic role in neuronal cell function.
16394100 These results highlight a role of Numb for dendritic spine development and synaptic functions with intersectin and EphB2.

AA Sequence

MMAQFPTAMNGGPNMWAITSEERTKHDRQFDNLKPSGGYITGDQARNFFLQSGLPAPVLAEIWALSDLNK      1 - 70
DGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMGSMPNLSIPQPLPPAAPITSL     71 - 140
SSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLIQPLPIPYSSSTLPHGSSYSLMMGGFGGASIQKAQS    141 - 210
LIDLGSSSSTSSTASLSGNSPKTGTSEWAVPQPTRLKYRQKFNTLDKSMSGYLSGFQARNALLQSNLSQT    211 - 280
QLATIWTLADVDGDGQLKAEEFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKM    281 - 350
QEEEPQKKLPVTFEDKRKANYERGNMELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQL    351 - 420
ELEKRLEKQRELERQREEERRKDIERREAAKQELERQRRLEWERIRRQELLNQKNREQEEIVRLNSKKKN    421 - 490
LHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQL    491 - 560
LNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLDALEKETASKLSEMDSFNNQLKCGNMDDSVL    561 - 630
QCLLSLLSCLNNLFLLLKELRETYNTQQLALEQLYKIKRDKLKEIERKRLELMQKKKLEDEAARKAKQGK    631 - 700
ENLWKENLRKEEEEKQKRLQEEKTQEKIQEEERKAEEKQRKDKDTLKAEEKKRETASVLVNYRALYPFEA    701 - 770
RNHDEMSFNSGDIIQVDEKTVGEPGWLYGSFQGNFGWFPCNYVEKMPSSENEKAVSPKKALLPPTVSLSA    771 - 840
TSTSSEPLSSNQPASVTDYQNVSFSNLTVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVENLKAQALCSWT    841 - 910
AKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVKREEPEALYAAVNKKPTSAAY    911 - 980
SVGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDQESFGSASKSGA    981 - 1050
SNKKPEIAQVTSAYVASGSEQLSLAPGQLILILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSE   1051 - 1120
RATPAFHPVCQVIAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQGEINGVTGLFPSNYVKMTTDSDPS   1121 - 1190
QQWCADLQTLDTMQPIERKRQGYIHELIQTEERYMADLQLVVEVFQKRMAESGFLTEGEMALIFVNWKEL   1191 - 1260
IMSNTKLLKALRVRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTDEDTDFKEFLK   1261 - 1330
KLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPESHADHSSLKLALERAEELCSQVNEGVREKE   1331 - 1400
NSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKLYKTKSNKELHGFLFNDFLLLTYMVKQFAV   1401 - 1470
SSGSEKLFSSKSNAQFKMYKTPIFLNEVLVKLPTDPSSDEPVFHISHIDRVYTLRTDNINERTAWVQKIK   1471 - 1540
AASEQYIDTEKKKREKAYQARSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTIQD   1541 - 1610
TLNPKWNFNCQFFIKDLYQDVLCLTLFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPMTRRLLLHEVPTG   1611 - 1680
EVWVRFDLQLFEQKTLL                                                        1681 - 1697
//

Text Mined References (45)

PMID Year Title
26633357 2015 ITSN2L Interacts with and Negatively Regulates RABEP1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25261932 2014 Genome-wide association study identifies multiple susceptibility loci for diffuse large B cell lymphoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
23936226 2013 Adaptor proteins intersectin 1 and 2 bind similar proline-rich ligands but are differentially recognized by SH2 domain-containing proteins.
23274495 2013 Crystal structure of human Intersectin-2L C2 domain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22648170 2012 The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin ?1 endocytosis.
22449706 2012 Human intersectin 2 (ITSN2) binds to Eps8 protein and enhances its degradation.
21269460 2011 Initial characterization of the human central proteome.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
20479469 2010 The Cdc42 GEF Intersectin 2 controls mitotic spindle orientation to form the lumen during epithelial morphogenesis.
20448150 2010 FCHo proteins are nucleators of clathrin-mediated endocytosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19718658 2009 Alternative splicing of ADAM15 regulates its interactions with cellular SH3 proteins.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19622753 2009 Intersectin-2L regulates caveola endocytosis secondary to Cdc42-mediated actin polymerization.
19458185 2009 Endocytic accessory proteins are functionally distinguished by their differential effects on the maturation of clathrin-coated pits.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17696407 2007 The K15 protein of Kaposi's sarcoma-associated herpesvirus recruits the endocytic regulator intersectin 2 through a selective SH3 domain interaction.
17390067 2007 Expression analysis of human intersectin 2 gene (ITSN2) minor splice variants showing differential expression in normal human brain.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16394100 2006 Role of numb in dendritic spine development with a Cdc42 GEF intersectin and EphB2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15231747 2004 A protein interaction framework for human mRNA degradation.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12766152 2003 Human claspin is required for replication checkpoint control.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
11748279 2001 The intersectin 2 adaptor links Wiskott Aldrich Syndrome protein (WASp)-mediated actin polymerization to T cell antigen receptor endocytosis.
11690630 2001 The human intersectin genes and their spliced variants are differentially expressed.
10922467 2000 Intersectin 2, a new multimodular protein involved in clathrin-mediated endocytosis.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9630982 1996 Cloning of ligand targets: systematic isolation of SH3 domain-containing proteins.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.