Property Summary

NCBI Gene PubMed Count 62
PubMed Score 72.01
PubTator Score 52.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Down syndrome 1.200 2.8e-03
adult high grade glioma -1.800 8.2e-05
aldosterone-producing adenoma -1.219 2.1e-02
astrocytoma -1.100 1.6e-15
Astrocytoma, Pilocytic -1.100 3.6e-05
atypical teratoid / rhabdoid tumor -1.400 4.8e-05
ductal carcinoma in situ -1.900 5.6e-04
ependymoma 1.800 5.0e-02
glioblastoma -1.300 4.6e-06
group 4 medulloblastoma 1.200 1.0e-06
invasive ductal carcinoma -2.600 5.6e-04
medulloblastoma, large-cell -2.100 1.4e-05
mucosa-associated lymphoid tissue lympho... 1.714 2.4e-02
non primary Sjogren syndrome sicca -1.100 2.2e-02
osteosarcoma 1.640 1.6e-06
ovarian cancer -1.700 4.8e-10
Pick disease 1.100 7.3e-03
primitive neuroectodermal tumor -1.300 8.4e-04
psoriasis -1.600 2.1e-08
subependymal giant cell astrocytoma -1.275 3.5e-02

Gene RIF (27)

AA Sequence

MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNND      1 - 70
GRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGIASMPPLTAVAPVPMGSIPVV     71 - 140
GMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLPKSSSFSRSGPGSQLNTKLQKAQSFDVASVP    141 - 210
PVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFI    211 - 280
LAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTF    281 - 350
EDKKRENFERGNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE    351 - 420
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEFELEALNDKKH    421 - 490
QLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSL    491 - 560
HRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERL    561 - 630
KQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQE    631 - 700
AQDKLGRLFHQHQEPAKPAVQAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVK    701 - 770
GEWVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTS    771 - 840
SEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQG    841 - 910
EKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMD    911 - 980
SGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWWTGTVGDKAGVF    981 - 1050
PSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARG   1051 - 1120
KKRQIGWFPANYVKLLSPGTSKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDP   1121 - 1190
DWWKGEVNGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVT   1191 - 1260
EIFQKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYI   1261 - 1330
RFCSRQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENH   1331 - 1400
PDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGPRKFLHSGKLY   1401 - 1470
KAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIF   1471 - 1540
HISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKP   1541 - 1610
CRSHGKSNPYCEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEI   1611 - 1680
RVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP                                1681 - 1721
//

Text Mined References (75)

PMID Year Title