Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.44
PubTator Score 7.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
osteosarcoma -1.539 6.3e-04
posterior fossa group A ependymoma 1.400 4.5e-08
glioblastoma 2.000 4.5e-06
cystic fibrosis 1.213 6.7e-04
atypical teratoid / rhabdoid tumor 2.000 6.8e-07
medulloblastoma, large-cell 1.100 1.1e-03
primitive neuroectodermal tumor 1.100 1.4e-04
primary pancreatic ductal adenocarcinoma 1.797 2.5e-03
intraductal papillary-mucinous adenoma (... -1.500 1.0e-03
ulcerative colitis 1.200 5.9e-04
interstitial cystitis 1.100 9.4e-05
pediatric high grade glioma 1.600 2.3e-05
sonic hedgehog group medulloblastoma 1.500 3.1e-04
subependymal giant cell astrocytoma 1.599 3.0e-02
lung adenocarcinoma -1.200 2.8e-08
psoriasis -1.100 4.1e-06
lung carcinoma -1.100 2.6e-10
ovarian cancer 1.200 4.4e-04
pituitary cancer -1.600 2.2e-05
pancreatic cancer 1.600 8.8e-03

Synonym

Accession Q8IWB1 D3DRA5 Q5JU17 Q96MS8 Q9C0A9
Symbols DANGER
KIAA1754
bA127L20
bA127L20.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16990268 DANGER appears to allosterically modulate the sensitivity of IP(3) RtoCa(2+) inhibition, which likely alters IP(3)R-mediated Ca(2+) dynamics in cells where DANGER and IP(3)R are co-expressed
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAMGLFRVCLVVVTAIINHPLLFPRENATVPENEEEIIRKMQAHQEKLQLEQLRLEEEVARLAAEKEALE      1 - 70
QVAEEGRQQNETRVAWDLWSTLCMILFLMIEVWRQDHQEGPSPECLGGEEDELPGLGGAPLQGLTLPNKA     71 - 140
TLGHFYERCIRGATADAARTREFLEGFVDDLLEALRSLCNRDTDMEVEDFIGVDSMYENWQVDRPLLCHL    141 - 210
FVPFTPPEPYRFHPELWCSGRSVPLDRQGYGQIKVVRADGDTLSCICGKTKLGEDMLCLLHGRNSMAPPC    211 - 280
GDMENLLCATDSLYLDTMQVMKWFQTALTRAWKGIAHKYEFDLAFGQLDSPGSLKIKFRSGKFMPFNLIP    281 - 350
VIQCDDSDLYFVSHLPREPSEGTPASSTDWLLSFAVYERHFLRTTLKALPEGACHLSCLQIASFLLSKQS    351 - 420
RLTGPSGLSSYHLKTALLHLLLLRQAADWKAGQLDARLHELLCFLEKSLLQKKLHHFFIGNRKVPEAMGL    421 - 490
PEAVLRAEPLNLFRPFVLQRSLYRKTLDSFYEMLKNAPALISEYSLHVPSDQPTPKS                 491 - 547
//

Text Mined References (17)

PMID Year Title
22514627 2012 PHYRN: a robust method for phylogenetic analysis of highly divergent sequences.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
17301879 2007 Ancient origin of the new developmental superfamily DANGER.
16990268 2006 DANGER, a novel regulatory protein of inositol 1,4,5-trisphosphate-receptor activity.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.