Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.66
PubTator Score 7.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active ulcerative colitis 1.042 2.6e-02
adult high grade glioma 1.200 1.4e-03
atypical teratoid / rhabdoid tumor 2.000 6.8e-07
cystic fibrosis 1.213 6.7e-04
ependymoma 1.300 2.6e-07
glioblastoma 1.200 4.9e-05
group 3 medulloblastoma 1.300 1.0e-02
interstitial cystitis 1.100 9.4e-05
intraductal papillary-mucinous adenoma (... -1.500 1.0e-03
lung adenocarcinoma -1.200 2.8e-08
lung carcinoma -1.100 2.6e-10
medulloblastoma, large-cell 1.100 1.1e-03
osteosarcoma -1.539 6.3e-04
ovarian cancer 1.200 4.4e-04
pancreatic cancer 1.600 8.8e-03
pituitary cancer -1.600 2.2e-05
primary pancreatic ductal adenocarcinoma 1.797 2.5e-03
primitive neuroectodermal tumor 1.100 1.4e-04
psoriasis -1.100 4.1e-06
subependymal giant cell astrocytoma 1.599 3.0e-02

Gene RIF (5)

AA Sequence

MAMGLFRVCLVVVTAIINHPLLFPRENATVPENEEEIIRKMQAHQEKLQLEQLRLEEEVARLAAEKEALE      1 - 70
QVAEEGRQQNETRVAWDLWSTLCMILFLMIEVWRQDHQEGPSPECLGGEEDELPGLGGAPLQGLTLPNKA     71 - 140
TLGHFYERCIRGATADAARTREFLEGFVDDLLEALRSLCNRDTDMEVEDFIGVDSMYENWQVDRPLLCHL    141 - 210
FVPFTPPEPYRFHPELWCSGRSVPLDRQGYGQIKVVRADGDTLSCICGKTKLGEDMLCLLHGRNSMAPPC    211 - 280
GDMENLLCATDSLYLDTMQVMKWFQTALTRAWKGIAHKYEFDLAFGQLDSPGSLKIKFRSGKFMPFNLIP    281 - 350
VIQCDDSDLYFVSHLPREPSEGTPASSTDWLLSFAVYERHFLRTTLKALPEGACHLSCLQIASFLLSKQS    351 - 420
RLTGPSGLSSYHLKTALLHLLLLRQAADWKAGQLDARLHELLCFLEKSLLQKKLHHFFIGNRKVPEAMGL    421 - 490
PEAVLRAEPLNLFRPFVLQRSLYRKTLDSFYEMLKNAPALISEYSLHVPSDQPTPKS                 491 - 547
//

Text Mined References (18)

PMID Year Title