Property Summary

NCBI Gene PubMed Count 78
PubMed Score 301.44
PubTator Score 597.25

Knowledge Summary

Patent (5,857)

Expression

Gene RIF (49)

PMID Text
26009177 the ability to generate tetramers with defined wild type and mutant subunits will be useful in probing fundamental questions relating to IP3Rs (R1, R2, R3) structure and function.
25966694 Studies indicate that the ryanodine receptors (RyRs: RyR1, RyR2, RyR3) and inositol 1,4,5-trisphosphate receptors (IP3Rs: IP3R1, IP3R2, IP3R3) are the major Ca(2+) release channels (CRCs) on the endo/sarcoplasmic reticulum (ER/SR).
25796361 The transcription factor NRF2 binds to the promoter of ITPR3 to inhibit its expression in cholangiocytes, leading to reduced calcium signaling and bile duct secretion.
25378392 miR-506 is a regulator of InsP3R3 expression and InsP3R3-mediated Ca2+ signaling and secretion.
24904548 IP3R differentially associates with HIV-1 wild-type Gag and P7L-Gag, indicating that Gag and IP3R are in proximity at the plasma membrane
24469450 Physiologically relevant reactive oxygen species controls cytoplasmic and mitochondrial calcium transport through IP3 receptors.
24285081 It mediate calcium release from intracellular calcium stores such as the ER into the cytoplasm. (review)
23992640 A molecular and functional link between BKCa channel and IP3R3 in cancer cells as an important mechanism for tumor cell proliferation.
23983250 The Galphaq-protein/coupled receptor/IP3R axis modulates the electromechanical properties of the human myocardium and its propensity to develop arrhythmias.
23955339 Studies indicate that three subtypes of inositol 1,4,5-trisphosphate (IP3) receptors (IP3R1, -2, and -3) are assembled to form homo- and heterotetrameric channels that mediate Ca(2+) release from intracellular stores.
23618877 in human pulmonary fibroblasts, PDGF acts through IP3-induced Ca(2+)-release to trigger Ca(2+) waves, which in turn modulate gene expression of several matrix proteins.
22552281 The presence of isoform III of inositol 1,4,5-trisphosphate receptor is the key point of Akt activity on calcium-mediated apoptosis.
22100703 The study provides biochemical evidence of the interaction between FKBP12 and RYR1, RYR3 and IP3R.
22082873 Ins(1,4,5)P3R-mediated Ca2+ signaling was critical for starvation-induced autophagy stimulation.
21875593 IP3R differentially associates with HIV-1 wild-type Gag and P7L-Gag, indicating that Gag and IP3R are in proximity at the plasma membrane
21762810 IP3R differentially associates with HIV-1 wild-type Gag and P7L-Gag, indicating that Gag and IP3R are in proximity at the plasma membrane
21501587 the critical region of KRAP protein for the regulation of IP(3)R was determined.
21075448 inositol 145-triphosphate receptor type 3 becomes expressed in colon cancer, and its expression level is directly related to aggressiveness of the tumor
20660057 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20618519 results of this study suggest that the rs2229634 SNP in the ITPR3 gene is associated with the risk of coronary artery aneurysm formation in Taiwanese Kawasaki disease patients
20618519 Observational study of gene-disease association. (HuGE Navigator)
20427533 IP3R differentially associates with HIV-1 wild-type Gag and P7L-Gag, indicating that Gag and IP3R are in proximity at the plasma membrane
20395455 Dystrophic (RCDMD) human muscle cells show 5-fold overexpression of IP(3)R2 and down-regulation of IP(3)R3 compared with normal human muscle cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20103623 Findings suggest IP(3)R3 as a novel therapeutic target and identify caffeine as a possible adjunct therapy to slow invasive growth of glioblastoma.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19706527 Data show that the BH4 domain mediates interaction of Bcl-2 with the inositol 1,4,5-trisphosphate (IP3) receptor on the endoplasmic reticulum.
19193873 Results demonstrate the importance of the InsP3 receptor-mutant huntingtin protein association for the pathogenesis of Huntington's disease and as a potential therapeutic target for Huntington's disease.
19052258 Caveolin-1 scaffold domain interacts with TRPC1 and IP3R3 to regulate Ca2+ store release-induced Ca2+ entry in endothelial cells.
19050248 Inability of the T-cell receptors in TCR transgenic mice to trigger calcium mobilization may be due to the insufficient level of inositol 1,4,5-triphosphate receptor (IP3) type 3 to initiate the release of calcium from intracellular stores.
18826956 IP3-mediated sensitization requires IP3 receptor binding to a TRPV4 C-terminal domain that overlaps with a previously described calmodulin-binding site
18586264 May play a role in calcium-dependent nuclear processes.
18544901 the agonist-induced clustering of IP(3)R is triggered by IP(3) binding, rather than [Ca(2+)](i) elevation.
18539593 sigma-1R overexpression drives sigma agonist-independent dissociation of ANK 220 from IP3R-3, resulting in activation
18434505 In this review, by sensing sequential binding of IP3 and calcium ions, the IP3 receptor acts as a coincidence detector that associates parallel fiber inputs with climbing fiber inputs.
18340361 The association between type 1 diabetes and the ITPR3 gene polymorphism due to linkage disequilibrium with HLA class II.
18340361 Observational study of gene-disease association. (HuGE Navigator)
18275062 the ankyrin-binding site is located on the cytoplasmic face of the InsP(3) receptor, thus validating the feasibility of in vivo ankyrin-InsP(3) receptor interactions.
18219441 A functional single nucleotide polymorphism in the NKX2.5-binding site of ITPR3 promoter is associated with susceptibility to systemic lupus erythematosus
18219441 Observational study of gene-disease association. (HuGE Navigator)
17496801 IP3R3 is present in the paranodal regions of the nodes in the sciatic nerve.
17437169 Anti-IP(3)R1 antibodies were present in 48.6% of primary Sjogren's syndrome and in 3.0% of normal healthy subjects.
16960798 The estimated population-attributable risk of 21.6% suggests that variation within ITPR3 reflects an important contribution to type 1 diabetes in Sweden.
14707143 differential expression of the IP(3)R subtype is critical for various forms of Ca(2+) signaling, and, particularly, IP(3)R1 and IP(3)R3 have opposite roles in generating Ca(2+) oscillations
14666665 IP3R3 may be a prerequisite for secretion of an enzyme, such as protease, in gastric cancer cells; results indicate that IP3R3 may be specifically involved in gastric cancer peritoneal dissemination
10843712 IP3R differentially associates with HIV-1 wild-type Gag and P7L-Gag, indicating that Gag and IP3R are in proximity at the plasma membrane

AA Sequence

MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVCPMNRYSAQKQ      1 - 70
YWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLP     71 - 140
ALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVGDKVILNPVNAGQPLHASNYELSDNAGCKEV    141 - 210
NSVNCNTSWKINLFMQFRDHLEEVLKGGDVVRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSN    211 - 280
ALWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGMGAQGRTGRRNAGEKI    281 - 350
KYCLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC    351 - 420
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLVFFVSDVPNNG    421 - 490
QNVLDIMVTKPNRERQKLMREQNILKQVFGILKAPFREKGGEGPLVRLEELSDQKNAPYQHMFRLCYRVL    491 - 560
RHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRF    561 - 630
LDYLSDLCVSNHIAIPVTQELICKCVLDPKNSDILIRTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKN    631 - 700
NEHHEKSVRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLP    701 - 770
FDLRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY    771 - 840
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPAMLQAYEDPGG    841 - 910
KNVRRSIQGVGHMMSTMVLSRKQSVFSAPSLSAGASAAEPLDRSKFEENEDIVVMETKLKILEILQFILN    911 - 980
VRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTTANMNLDRIGEQAEAMFGVGKTSSMLEVDDE    981 - 1050
GGRMFLRVLIHLTMHDYAPLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTM   1051 - 1120
VEKSELWVDKKGSGKGEEVEAGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMR   1121 - 1190
KKQQRLLKNMDAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE   1191 - 1260
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDMIMTELTNAGD   1261 - 1330
DVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVSVV   1331 - 1400
THEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTLFENFTLDMARVCSKREKRVADPTLEKYVLS   1401 - 1470
VVLDTINAFFSSPFSENSTSLQTHQTIVVQLLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAILL   1471 - 1540
PMDLDAHISSMLSSGASCAAAAQRNASSYKATTRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLV   1541 - 1610
QAELSVLVDVLHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG   1611 - 1680
DRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIF   1681 - 1750
QESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMNDLGSQPHEDRE   1751 - 1820
PVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQSSEMGTSVLIMQPILRFLQLLCENHNRDLQN   1821 - 1890
FLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIV   1891 - 1960
THESNGIDIITALILNDISPLCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIK   1961 - 2030
KAYLQEEERENSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML   2031 - 2100
KSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTEQDEQGSKVSD   2101 - 2170
FFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIAFFYPYMEGASTGVLDSPLIS   2171 - 2240
LLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRG   2241 - 2310
YKAMVMDMEFLYHVGYILTSVLGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILV   2311 - 2380
YLFSIVGFLFLKDDFILEVDRLPNNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGLSVPEVLEEDRELDS   2381 - 2450
TERACDTLLMCIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF   2451 - 2520
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYV   2521 - 2590
AQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLTAQLNELKEQMTEQRKRRQRL   2591 - 2660
GFVDVQNCISR                                                              2661 - 2671
//

Text Mined References (86)

PMID Year Title
26009177 2015 Using concatenated subunits to investigate the functional consequences of heterotetrameric inositol 1,4,5-trisphosphate receptors.
25996873 2015 TMEM203 Is a Novel Regulator of Intracellular Calcium Homeostasis and Is Required for Spermatogenesis.
25966694 2015 Essential Roles of Intracellular Calcium Release Channels in Muscle, Brain, Metabolism, and Aging.
25796361 2015 Nuclear Factor, Erythroid 2-Like 2 Regulates Expression of Type 3 Inositol 1,4,5-Trisphosphate Receptor and Calcium Signaling in Cholangiocytes.
25378392 2015 Post-translational regulation of the type III inositol 1,4,5-trisphosphate receptor by miRNA-506.
24469450 2014 Isoform- and species-specific control of inositol 1,4,5-trisphosphate (IP3) receptors by reactive oxygen species.
24285081 2013 Regulatory mechanisms and pathophysiological significance of IP3 receptors and ryanodine receptors in drug dependence.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23992640 2013 Molecular interaction and functional coupling between type 3 inositol 1,4,5-trisphosphate receptor and BKCa channel stimulate breast cancer cell proliferation.
23983250 2013 Inositol 1, 4, 5-trisphosphate receptors and human left ventricular myocytes.
23955339 2013 Functional inositol 1,4,5-trisphosphate receptors assembled from concatenated homo- and heteromeric subunits.
23936024 2013 Early insights into the function of KIAA1199, a markedly overexpressed protein in human colorectal tumors.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
23618877 2013 Platelet derived growth factor-evoked Ca2+ wave and matrix gene expression through phospholipase C in human pulmonary fibroblast.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22552281 2012 Selective modulation of subtype III IP?R by Akt regulates ER Ca²? release and apoptosis.
22100703 2012 Characterization of the binding sites for the interactions between FKBP12 and intracellular calcium release channels.
22082873 2011 Ins(1,4,5)P3 receptor-mediated Ca2+ signaling and autophagy induction are interrelated.
21900946 2011 Identification of independent risk loci for Graves' disease within the MHC in the Japanese population.
21501587 2011 Determination of the critical region of KRAS-induced actin-interacting protein for the interaction with inositol 1,4,5-trisphosphate receptor.
21269460 2011 Initial characterization of the human central proteome.
21075448 2010 The type III inositol 1,4,5-trisphosphate receptor is associated with aggressiveness of colorectal carcinoma.
21062895 2010 Agonist-activated Ca2+ influx occurs at stable plasma membrane and endoplasmic reticulum junctions.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20660057 2010 Association between common variation in genes encoding sweet taste signaling components and human sucrose perception.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20618519 2010 Single nucleotide polymorphism rs2229634 in the ITPR3 gene is associated with the risk of developing coronary artery aneurysm in children with Kawasaki disease.
20558539 2010 Common genetic variants associate with serum phosphorus concentration.
20395455 2010 Abnormal distribution of inositol 1,4,5-trisphosphate receptors in human muscle can be related to altered calcium signals and gene expression in Duchenne dystrophy-derived cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20103623 2010 Caffeine-mediated inhibition of calcium release channel inositol 1,4,5-trisphosphate receptor subtype 3 blocks glioblastoma invasion and extends survival.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19706527 2009 The BH4 domain of Bcl-2 inhibits ER calcium release and apoptosis by binding the regulatory and coupling domain of the IP3 receptor.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19553469 2009 Human Golgi antiapoptotic protein modulates intracellular calcium fluxes.
19553259 2009 Common body mass index-associated variants confer risk of extreme obesity.
19193873 2009 Neuroprotective effects of inositol 1,4,5-trisphosphate receptor C-terminal fragment in a Huntington's disease mouse model.
19052258 2009 Caveolin-1 scaffold domain interacts with TRPC1 and IP3R3 to regulate Ca2+ store release-induced Ca2+ entry in endothelial cells.
19050248 2008 IP3 receptor-mediated Ca2+ release in naive CD4 T cells dictates their cytokine program.
18826956 2008 IP3 receptor binds to and sensitizes TRPV4 channel to osmotic stimuli via a calmodulin-binding site.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18586264 2008 Wide long lasting perinuclear Ca2+ release events generated by an interaction between ryanodine and IP3 receptors in canine Purkinje cells.
18544901 2008 The clustering of inositol 1,4,5-trisphosphate (IP(3)) receptors is triggered by IP(3) binding and facilitated by depletion of the Ca(2+) store.
18539593 2008 Role of sigma-1 receptor C-terminal segment in inositol 1,4,5-trisphosphate receptor activation: constitutive enhancement of calcium signaling in MCF-7 tumor cells.
18434505 2008 The calcium kinetics and inositol trisphosphate receptor properties shape the asymmetric timing window of coincidence detection.
18340361 2008 The association between type 1 diabetes and the ITPR3 gene polymorphism due to linkage disequilibrium with HLA class II.
18275062 2008 Revisiting ankyrin-InsP3 receptor interactions: ankyrin-B associates with the cytoplasmic N-terminus of the InsP3 receptor.
18219441 2008 A functional SNP in the NKX2.5-binding site of ITPR3 promoter is associated with susceptibility to systemic lupus erythematosus in Japanese population.
17496801 2007 Expression of IP3 receptor isoforms at the nodes of Ranvier in rat sciatic nerve.
17437169 2007 Inositol 1,4,5-trisphosphate receptors are autoantibody target antigens in patients with Sjögren's syndrome and other systemic rheumatic diseases.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16960798 2006 Genetic mapping at 3-kilobase resolution reveals inositol 1,4,5-triphosphate receptor 3 as a risk factor for type 1 diabetes in Sweden.
15623527 2005 Apical localization of a functional TRPC3/TRPC6-Ca2+-signaling complex in polarized epithelial cells. Role in apical Ca2+ influx.
15051494 2004 CD44 interaction with ankyrin and IP3 receptor in lipid rafts promotes hyaluronan-mediated Ca2+ signaling leading to nitric oxide production and endothelial cell adhesion and proliferation.
14707143 2004 Distinct roles of inositol 1,4,5-trisphosphate receptor types 1 and 3 in Ca2+ signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685260 2004 Regulation of InsP3 receptor activity by neuronal Ca2+-binding proteins.
14666665 Possible involvement of inositol 1,4,5-trisphosphate receptor type 3 (IP3R3) in the peritoneal dissemination of gastric cancers.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12606721 2003 Nuclear and cytosolic calcium are regulated independently.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032348 2002 Identification of a family of calcium sensors as protein ligands of inositol trisphosphate receptor Ca(2+) release channels.
11524429 2001 Stabilization of cortical actin induces internalization of transient receptor potential 3 (Trp3)-associated caveolar Ca2+ signaling complex and loss of Ca2+ influx without disruption of Trp3-inositol trisphosphate receptor association.
11413485 2000 The versatility and universality of calcium signalling.
11290752 2001 Identification of common binding sites for calmodulin and inositol 1,4,5-trisphosphate receptors on the carboxyl termini of trp channels.
11163362 2001 Alternative splice variants of hTrp4 differentially interact with the C-terminal portion of the inositol 1,4,5-trisphosphate receptors.
11149946 2001 Regulating ankyrin dynamics: Roles of sigma-1 receptors.
11035010 2001 Mapping of the ATP-binding sites on inositol 1,4,5-trisphosphate receptor type 1 and type 3 homotetramers by controlled proteolysis and photoaffinity labeling.
10980191 2000 Expression of truncated transient receptor potential protein 1alpha (Trp1alpha ): evidence that the Trp1 C terminus modulates store-operated Ca2+ entry.
10874040 2000 Evidence that type I, II, and III inositol 1,4,5-trisphosphate receptors can occur as integral plasma membrane proteins.
10843712 2000 Release of calcium from inositol 1,4,5-trisphosphate receptor-regulated stores by HIV-1 Tat regulates TNF-alpha production in human macrophages.
10828023 2000 Distinct localization and function of (1,4,5)IP(3) receptor subtypes and the (1,3,4,5)IP(4) receptor GAP1(IP4BP) in highly purified human platelet membranes.
10692497 2000 Calmodulin increases the sensitivity of type 3 inositol-1,4, 5-trisphosphate receptors to Ca(2+) inhibition in human bronchial mucosal cells.
10611319 1999 Modulation of Ca(2+) entry by polypeptides of the inositol 1,4, 5-trisphosphate receptor (IP3R) that bind transient receptor potential (TRP): evidence for roles of TRP and IP3R in store depletion-activated Ca(2+) entry.
8388391 1993 Sequence and functional characterization of a third inositol trisphosphate receptor subtype, IP3R-3, expressed in pancreatic islets, kidney, gastrointestinal tract, and other tissues.
8385102 1993 The involvement of ankyrin in the regulation of inositol 1,4,5-trisphosphate receptor-mediated internal Ca2+ release from Ca2+ storage vesicles in mouse T-lymphoma cells.
8288584 1994 Primary structure, ligand binding, and localization of the human type 3 inositol 1,4,5-trisphosphate receptor expressed in intestinal epithelium.
8081734 1994 Cloning and characterization of human type 2 and type 3 inositol 1,4,5-trisphosphate receptors.
7559486 1995 Heteroligomers of type-I and type-III inositol trisphosphate receptors in WB rat liver epithelial cells.
1693919 1990 Receptor-activated single channels in intact human platelets.