Property Summary

NCBI Gene PubMed Count 52
PubMed Score 72.50
PubTator Score 43.96

Knowledge Summary

Patent (1,862)

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -2.100 2.5e-07
astrocytic glioma 2.000 1.9e-02
psoriasis -1.700 7.1e-05
cutaneous lupus erythematosus -1.100 2.3e-02
osteosarcoma -1.204 4.9e-02
group 4 medulloblastoma -1.800 8.3e-04
cystic fibrosis 1.520 4.3e-05
glioblastoma 1.100 5.5e-03
medulloblastoma, large-cell -1.400 1.4e-02
tuberculosis 1.100 2.8e-06
lung cancer 3.000 2.2e-06
Breast cancer 2.700 2.7e-02
adult high grade glioma 1.700 1.3e-04
pilocytic astrocytoma 1.700 1.2e-06
subependymal giant cell astrocytoma 2.775 2.3e-02
ovarian cancer -1.700 2.2e-03
pituitary cancer 2.100 5.2e-06

Gene RIF (35)

PMID Text
26694163 Data suggest miR-1290 as the new oncomiR involved in laryngeal squamous cell carcinoma pathogenesis probably through downregulation of its target genes MAF and ITPR2.
26009177 the ability to generate tetramers with defined wild type and mutant subunits will be useful in probing fundamental questions relating to IP3Rs (R1, R2, R3) structure and function.
25966694 Studies indicate that the ryanodine receptors (RyRs: RyR1, RyR2, RyR3) and inositol 1,4,5-trisphosphate receptors (IP3Rs: IP3R1, IP3R2, IP3R3) are the major Ca(2+) release channels (CRCs) on the endo/sarcoplasmic reticulum (ER/SR).
25779662 High expression of inositol 1,4,5-trisphosphate receptor, type 2 is associated with acute myeloid leukemia.
25499268 Disrupting IP3R/Bcl-2 interaction therefore leads in those cells to increased Ca(2) release and apoptosis. Intriguingly, IP3R2 is not only implicated in apoptosis but also in the induction of senescence, another tumour-suppressive mechanism.
25329695 Loss of InsP3R2-mediated calcium release causes isolated anhidrosis in humans.
25303641 A genome-wide association study identifies ITPR2 as a susceptibility gene for Kashin-Beck disease in Han Chinese.
24904548 IP3R differentially associates with HIV-1 wild-type Gag and P7L-Gag, indicating that Gag and IP3R are in proximity at the plasma membrane
24797322 results show a functional role of calcium release by the ITPR2 channel and its subsequent accumulation in the mitochondria
24415751 ITPR2 and hypertrophy specific gene expression is regulated, in part, by a positive feedback regulation between InsP3R2 and calcineurin-NFATc signaling pathways.
23983250 The Galphaq-protein/coupled receptor/IP3R axis modulates the electromechanical properties of the human myocardium and its propensity to develop arrhythmias.
23955339 Studies indicate that three subtypes of inositol 1,4,5-trisphosphate (IP3) receptors (IP3R1, -2, and -3) are assembled to form homo- and heterotetrameric channels that mediate Ca(2+) release from intracellular stores.
23582047 These results suggest an involvement of hydrogen sulfide in both IP3-induced calcium signalling and induction of apoptosis, possibly through the activation of endoplasmic reticulum stress.
23131553 These data suggest that ER Ca(2+) released by IP(3) receptors may be detrimental in amyotrophic lateral sclerosis and that motor neurons are vulnerable to impaired Ca(2+) metabolism.
21852551 Functional IP3R2s are expressed in the mouse sinoatrial node and could serve as an additional divalent calcium ion-dependent mechanism in modulating cardiac pacemaker.
21762810 IP3R differentially associates with HIV-1 wild-type Gag and P7L-Gag, indicating that Gag and IP3R are in proximity at the plasma membrane
21555518 ITPR2 is a functional target gene of the BACH1 transcription factor according to ChIP-seq and knockdown analysis in HEK 293 cells.
21063100 The knock down of IP3R-2 significantly reduced the intracellular Ca2+ response and this reduced Ca2+ response did not affect the activation of CREB but significantly decreased the activation of NFAT.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20427533 IP3R differentially associates with HIV-1 wild-type Gag and P7L-Gag, indicating that Gag and IP3R are in proximity at the plasma membrane
20395455 Dystrophic (RCDMD) human muscle cells show 5-fold overexpression of IP(3)R2 and down-regulation of IP(3)R3 compared with normal human muscle cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19590686 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19549843 Elevated InsP(3)R2 expression was also detected in hearts from human patients with heart failure after ischemic dilated cardiomyopathy, as well as in aortic-banded hypertrophic mouse hearts.
19464757 The result of this study suggested that ITPR2 that do not modulate the risk for SALS in the German population.
19193627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18936250 Parathyroid hormone communicates with IP(3)R via "cAMP junctions" that allow local delivery of a supramaximal concentration of cAMP to IP(3)R, directly increasing their sensitivity to IP(3).
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18249094 Provide evidence for a functional role of the de novo coupling between hTRPC1 and IP3RII in the activation of store operated calcium entry in platelets.
17827064 Observational study of gene-disease association. (HuGE Navigator)
17827064 Genetic variation is susceptibility factor for amyotrophic lateral sclerosis(ALS). Involved in glutamate-mediated neurotransmission, is one of main regulators of intracellular calcium concentrations, and has important role in apoptosis.
17437169 Antibodies are detected most frequently in rheumatoid arthritis.
10843712 IP3R differentially associates with HIV-1 wild-type Gag and P7L-Gag, indicating that Gag and IP3R are in proximity at the plasma membrane

AA Sequence

MTEKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKVCPMNRYSAQK      1 - 70
QYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNVIQLLHIKSNKYLTVNKRLPA     71 - 140
LLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGDKVVLMPVNAGQPLHASNIELLDNPGCKEVN    141 - 210
AVNCNTSWKITLFMKYSSYREDVLKGGDVVRLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKA    211 - 280
LWEIEVVHHDPCRGGAGQWNSLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGVPPTSKKKRQAGEKI    281 - 350
MYTLVSVPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC    351 - 420
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLIFFVADVPNNG    421 - 490
QEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDLGDQRYAPYKYMLRLCYRVL    491 - 560
RHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLHNNRKLLEKHITAKEIETFVSLLRRNREPRF    561 - 630
LDYLSDLCVSNTTAIPVTQELICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDS    631 - 700
NKEPHGKAIRHLAQEAKEGTKADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESL    701 - 770
PFDLRASFCRLMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE    771 - 840
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPMSSYFERLSKF    841 - 910
QDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPTEHEDVTVMDTKLKIIEILQFI    911 - 980
LSVRLDYRISYMLSIYKKEFGEDNDNAETSASGSPDTLLPSAIVPDIDEIAAQAETMFAGRKEKNPVQLD    981 - 1050
DEGGRTFLRVLIHLIMHDYPPLLSGALQLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLR   1051 - 1120
LTVEKSELWVEKSSNYENGEIGESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLS   1121 - 1190
KLCVQNKKCRNQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL   1191 - 1260
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADGKYVKKCQDM   1261 - 1330
VMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVELLAACTEGKNVYTEIKCNSL   1331 - 1400
LPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEIYTSNHIWKLFENFLVDMARVCNTTTDRKH   1401 - 1470
ADIFLEKCVTESIMNIVSGFFNSPFSDNSTSLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTL   1471 - 1540
AEVAKNRGIAIPVDLDSQVNTLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVV   1541 - 1610
ASLEHQFSPMMQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE   1611 - 1680
MLEKKDSFVEEGNTLRKILLNRYFKGDYSIGVNGHLSGAYSKTAQVGGSFSGQDSDKMGISMSDIQCLLD   1681 - 1750
KEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQKKSEKFFKVLYDRMKAAQKE   1751 - 1820
IRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSTLHLKEGMKGQLTEASSATSKAYCVYRREMDPEID   1821 - 1890
IMCTGPEAGNTEEKSAEEVTMSPAIAIMQPILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLD   1891 - 1960
CICGSTTGGLGLLGLYINEKNVALVNQNLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLG   1961 - 2030
KYRMDLVLQLKNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVS   2031 - 2100
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYANHTAQIEIVRHDRTMEQIVFPVPNICE   2101 - 2170
YLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSRHISLWGSISFNLAVFI   2171 - 2240
NLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFFFSKPVGIRPFLVSIMLRSIYTIGLGPTLIL   2241 - 2310
LGAANLCNKIVFLVSFVGNRGTFTRGYRAVILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREET   2311 - 2380
LLNVIKSVTRNGRSIILTAVLALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMME   2381 - 2450
ACAKENCSPTIPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY   2451 - 2520
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMW   2521 - 2590
HYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGDSEQNEIRSLQEKLESTMSLV   2591 - 2660
KQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPPH                                2661 - 2701
//

Text Mined References (58)

PMID Year Title
26694163 2015 Global miRNA Expression Profiling Identifies miR-1290 as Novel Potential oncomiR in Laryngeal Carcinoma.
26009177 2015 Using concatenated subunits to investigate the functional consequences of heterotetrameric inositol 1,4,5-trisphosphate receptors.
25966694 2015 Essential Roles of Intracellular Calcium Release Channels in Muscle, Brain, Metabolism, and Aging.
25779662 2015 High expression of inositol 1,4,5-trisphosphate receptor, type 2 (ITPR2) as a novel biomarker for worse prognosis in cytogenetically normal acute myeloid leukemia.
25499268 2015 The type 2 inositol 1,4,5-trisphosphate receptor, emerging functions for an intriguing Ca²?-release channel.
25329695 2014 Abolished InsP3R2 function inhibits sweat secretion in both humans and mice.
25303641 2015 Genome-wide association study identifies ITPR2 as a susceptibility gene for Kashin-Beck disease in Han Chinese.
24797322 2014 Endoplasmic reticulum calcium release through ITPR2 channels leads to mitochondrial calcium accumulation and senescence.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24415751 2014 Calcineurin-NFATc regulates type 2 inositol 1,4,5-trisphosphate receptor (InsP3R2) expression during cardiac remodeling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23983250 2013 Inositol 1, 4, 5-trisphosphate receptors and human left ventricular myocytes.
23955339 2013 Functional inositol 1,4,5-trisphosphate receptors assembled from concatenated homo- and heteromeric subunits.
23582047 2013 Sulphide signalling potentiates apoptosis through the up-regulation of IP3 receptor types 1 and 2.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23131553 2012 Neuronal overexpression of IP? receptor 2 is detrimental in mutant SOD1 mice.
22010048 2012 A genome-wide association study identifies a novel susceptibility locus for renal cell carcinoma on 12p11.23.
21852551 2011 Distribution and functional role of inositol 1,4,5-trisphosphate receptors in mouse sinoatrial node.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21269460 2011 Initial characterization of the human central proteome.
21063100 2010 The transcription factors NFAT and CREB have different susceptibilities to the reduced Ca2+ responses caused by the knock down of inositol trisphosphate receptor in HEK 293A cells.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20395455 2010 Abnormal distribution of inositol 1,4,5-trisphosphate receptors in human muscle can be related to altered calcium signals and gene expression in Duchenne dystrophy-derived cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19590686 2009 Postural changes in blood pressure associated with interactions between candidate genes for chronic respiratory diseases and exposure to particulate matter.
19549843 2009 Increased InsP3Rs in the junctional sarcoplasmic reticulum augment Ca2+ transients and arrhythmias associated with cardiac hypertrophy.
19464757 2011 No evidence of association of FLJ10986 and ITPR2 with ALS in a large German cohort.
19193627 2009 A two-stage genome-wide association study of sporadic amyotrophic lateral sclerosis.
19120137 2008 Hypoxia differently modulates gene expression of inositol 1,4,5-trisphosphate receptors in mouse kidney and HEK 293 cell line.
18936250 2008 Selective coupling of type 6 adenylyl cyclase with type 2 IP3 receptors mediates direct sensitization of IP3 receptors by cAMP.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18249094 2008 Functional relevance of the de novo coupling between hTRPC1 and type II IP3 receptor in store-operated Ca2+ entry in human platelets.
17827064 2007 ITPR2 as a susceptibility gene in sporadic amyotrophic lateral sclerosis: a genome-wide association study.
17437169 2007 Inositol 1,4,5-trisphosphate receptors are autoantibody target antigens in patients with Sjögren's syndrome and other systemic rheumatic diseases.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
12032348 2002 Identification of a family of calcium sensors as protein ligands of inositol trisphosphate receptor Ca(2+) release channels.
11694504 2002 Phosphorylation of inositol 1,4,5-trisphosphate receptors in parotid acinar cells. A mechanism for the synergistic effects of cAMP on Ca2+ signaling.
11413485 2000 The versatility and universality of calcium signalling.
11336651 2001 Activation of store-mediated calcium entry by secretion-like coupling between the inositol 1,4,5-trisphosphate receptor type II and human transient receptor potential (hTrp1) channels in human platelets.
11163362 2001 Alternative splice variants of hTrp4 differentially interact with the C-terminal portion of the inositol 1,4,5-trisphosphate receptors.
11053263 2000 Characterization of gene expression in human trabecular meshwork using single-pass sequencing of 1060 clones.
11013462 2000 Selective down-regulation of IP(3)receptor subtypes by caspases and calpain during TNF alpha -induced apoptosis of human T-lymphoma cells.
10970773 2000 Coupling between inositol 1,4,5-trisphosphate receptors and human transient receptor potential channel 1 when intracellular Ca2+ stores are depleted.
10874040 2000 Evidence that type I, II, and III inositol 1,4,5-trisphosphate receptors can occur as integral plasma membrane proteins.
10843712 2000 Release of calcium from inositol 1,4,5-trisphosphate receptor-regulated stores by HIV-1 Tat regulates TNF-alpha production in human macrophages.
10828023 2000 Distinct localization and function of (1,4,5)IP(3) receptor subtypes and the (1,3,4,5)IP(4) receptor GAP1(IP4BP) in highly purified human platelet membranes.
9729462 1998 Muscle-specific mRNA isoform encodes a protein composed mainly of the N-terminal 175 residues of type 2 Ins(1,4,5)P3 receptor.
8081734 1994 Cloning and characterization of human type 2 and type 3 inositol 1,4,5-trisphosphate receptors.
1693919 1990 Receptor-activated single channels in intact human platelets.