Property Summary

Ligand Count 1
NCBI Gene PubMed Count 24
PubMed Score 28.04
PubTator Score 28.95

Knowledge Summary

Patent (625)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.500 2.3e-03
astrocytic glioma -1.700 1.3e-03
Astrocytoma, Pilocytic -3.000 1.1e-06
atypical teratoid / rhabdoid tumor -3.200 4.6e-12
ependymoma -1.900 2.2e-03
glioblastoma -2.200 3.6e-07
group 3 medulloblastoma -2.600 1.2e-02
lung adenocarcinoma 3.100 7.3e-10
medulloblastoma, large-cell -3.400 6.2e-07
oligodendroglioma -1.400 2.3e-02
primitive neuroectodermal tumor -2.600 1.4e-05
ulcerative colitis -1.500 4.8e-07

 MGI Phenotype (1)

Gene RIF (10)

AA Sequence

MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAKRRGGQVPNGL      1 - 70
PRAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRLSTSSVSSTGSSSLLEDSEDD     71 - 140
LLSDSESRSRGNVQLEAGEDVGQKNHWQKIRTMVNLPVISPFKKRYAWVQLAGHTGSFKAAGTSGLILKR    141 - 210
CSEPERYCLARLMADALRGCVPAFHGVVERDGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARE    211 - 280
RPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTR    281 - 350
SREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT    351 - 420
TPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER                                 421 - 461
//

Text Mined References (25)

PMID Year Title