Property Summary

NCBI Gene PubMed Count 23
PubMed Score 25.78
PubTator Score 28.95

Knowledge Summary

Patent (625)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -2.000 1.1e-25
posterior fossa group B ependymoma -2.700 7.7e-09
oligodendroglioma -1.900 3.3e-20
glioblastoma -2.500 1.1e-05
medulloblastoma -3.400 6.1e-10
atypical teratoid / rhabdoid tumor -3.200 4.6e-12
medulloblastoma, large-cell -3.400 6.2e-07
primitive neuroectodermal tumor -2.600 1.4e-05
adult high grade glioma -2.500 2.3e-03
pilocytic astrocytoma -2.900 1.4e-06
lung adenocarcinoma 3.100 7.3e-10
ulcerative colitis -1.500 4.8e-07

 MGI Phenotype (1)

Gene RIF (9)

PMID Text
26249031 Our data indicated that ITPKA expression was significantly up-regulated in hepatocellular carcinoma and could serve as a potential novel prognostic biomarker
25101901 describe the crystal structure of the complex between human Ca2+/CaM and the CaM-binding region of human IP3-3K isoform A (residues 158-183)
21792881 we conclude that the observed expression of ITPKA early in tumor development increases the metastatic potential of lung adenocarcinoma cells.
20022963 Inositol 1,4,5-trisphosphate 3-kinase-A is a new cell motility-promoting protein that increases the metastatic potential of tumor cells by two functional activities.
18498254 the morphological changes induced by IP3K-A are mediated by non-enzymatic activities of the protein.
18187620 Knockdown of inositol-trisphosphate 3-kinase A (ITPKA) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16525636 Data suggest that ITPKA may be related to carcinogenesis by the modulation of inositol polyphosphates and Ca2+ homeostasis and that ITPKA may be a potential novel molecular target and biomarker.
15350214 We report the structure of an IPK, the human Ins(1,4,5)P3 3-kinase-A, both free and in complexes with substrates and products.
12747803 results highlight the potential role of the three isoforms of InsP3 3-kinase as direct InsP3 metabolizing enzymes and direct regulators of Ca2+ responses to extracellular signals

AA Sequence

MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAKRRGGQVPNGL      1 - 70
PRAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRLSTSSVSSTGSSSLLEDSEDD     71 - 140
LLSDSESRSRGNVQLEAGEDVGQKNHWQKIRTMVNLPVISPFKKRYAWVQLAGHTGSFKAAGTSGLILKR    141 - 210
CSEPERYCLARLMADALRGCVPAFHGVVERDGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARE    211 - 280
RPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTR    281 - 350
SREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT    351 - 420
TPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER                                 421 - 461
//

Text Mined References (24)

PMID Year Title
26249031 2015 ITPKA expression is a novel prognostic factor in hepatocellular carcinoma.
25101901 2014 A new calmodulin-binding motif for inositol 1,4,5-trisphosphate 3-kinase regulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21792881 2011 Functional role of inositol-1,4,5-trisphosphate-3-kinase-A for motility of malignant transformed cells.
20022963 2010 Inositol 1,4,5-trisphosphate 3-kinase-A is a new cell motility-promoting protein that increases the metastatic potential of tumor cells by two functional activities.
18498254 2008 Ins(1,4,5)P3 3-kinase-A overexpression induces cytoskeletal reorganization via a kinase-independent mechanism.
16525636 2006 Down-regulation of 1D-myo-inositol 1,4,5-trisphosphate 3-kinase A protein expression in oral squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15350214 2004 Structure of a human inositol 1,4,5-trisphosphate 3-kinase: substrate binding reveals why it is not a phosphoinositide 3-kinase.
12747803 2003 The three isoenzymes of human inositol-1,4,5-trisphosphate 3-kinase show specific intracellular localization but comparable Ca2+ responses on transfection in COS-7 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12202356 2002 Simulations of inositol phosphate metabolism and its interaction with InsP(3)-mediated calcium release.
11468283 2001 Inositol 1,4,5-trisphosphate 3-kinase A associates with F-actin and dendritic spines via its N terminus.
9374536 1997 Expression, purification, and regulation of two isoforms of the inositol 1,4,5-trisphosphate 3-kinase.
9155020 1997 D-myo-inositol 1,4,5-trisphosphate 3-kinase A is activated by receptor activation through a calcium:calmodulin-dependent protein kinase II phosphorylation mechanism.
2824270 1987 Catalytic properties of inositol trisphosphate kinase: activation by Ca2+ and calmodulin.
2176078 1990 Cloning and expression in Escherichia coli of a rat brain cDNA encoding a Ca2+/calmodulin-sensitive inositol 1,4,5-trisphosphate 3-kinase.
2175886 1990 Human brain inositol 1,4,5-trisphosphate 3-kinase cDNA sequence.
2167676 1990 Phosphorylation by protein kinase C inactivates an inositol 1,4,5-trisphosphate 3-kinase purified from human platelets.
1847047 1991 Molecular cloning and expression of a human brain inositol 1,4,5-trisphosphate 3-kinase.
1660262 1991 Identification of residues essential for catalysis and binding of calmodulin in rat brain inositol 1,4,5-trisphosphate 3-kinase.
1654894 1991 Molecular cloning and expression of a new putative inositol 1,4,5-trisphosphate 3-kinase isoenzyme.
1330886 1992 Localization of the genes for human inositol 1,4,5-trisphosphate 3-kinase A (ITPKA) and B (ITPKB) to chromosome regions 15q14-q21 and 1q41-q43, respectively, by in situ hybridization.