Property Summary

NCBI Gene PubMed Count 22
PubMed Score 23.13
PubTator Score 17.63

Knowledge Summary

Patent (806)

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.673 9.4e-04
posterior fossa group A ependymoma -1.200 7.2e-06
glioblastoma -1.400 3.7e-04
group 4 medulloblastoma -2.000 2.3e-09
atypical teratoid/rhabdoid tumor -1.900 1.6e-12
medulloblastoma, large-cell -1.600 3.8e-05
primitive neuroectodermal tumor -1.300 1.6e-03
intraductal papillary-mucinous neoplasm ... -1.100 3.1e-02
fibroadenoma -1.500 1.1e-02
pediatric high grade glioma -1.500 1.8e-06
ductal carcinoma in situ -1.100 4.4e-03
ovarian cancer 1.300 4.8e-05

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (9)

PMID Text
24465924 The results suggested that the maternal rs3783903 of ITPK1 might be associated with spina bifida, and the allele G of rs3783903 might affect the binding of AP-1 and the decrease of maternal plasma inositol hexakisphosphate concentration.
22928859 Activation of PLC by an endogenous cytokine (GBP) in Drosophila S3 cells and its application as a model for studying inositol phosphate signalling through ITPK1.
22308441 HEK293 cells stably expressing acetylated ITPK1 had reduced levels of the higher phosphorylated forms of inositol, compared with the levels seen in cells expressing unacetylated ITPK1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
17616525 analysis of inositol phosphate signaling pathway integration via human ITPK1
12925536 5/6-kinase modifies TNFalpha-induced apoptosis by interfering with the activation of TNF-R1-associated death domain

AA Sequence

MQTFLKGKRVGYWLSEKKIKKLNFQAFAELCRKRGMEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQN      1 - 70
DSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYMEDDRICSPPFMELTSLCGDD     71 - 140
TMRLLEKNGLTFPFICKTRVAHGTNSHEMAIVFNQEGLNAIQPPCVVQNFINHNAVLYKVFVVGESYTVV    141 - 210
QRPSLKNFSAGTSDRESIFFNSHNVSKPESSSVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGI    211 - 280
DIIINNQTGQHAVIDINAFPGYEGVSEFFTDLLNHIATVLQGQSTAMAATGDVALLRHSKLLAEPAGGLV    281 - 350
GERTCSASPGCCGSMMGQDAPWKAEADAGGTAKLPHQRLGCNAGVSPSFQQHCVASLATKASSQ          351 - 414
//

Text Mined References (25)

PMID Year Title
24465924 2014 The maternal ITPK1 gene polymorphism is associated with neural tube defects in a high-risk Chinese population.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22928859 2012 Activation of PLC by an endogenous cytokine (GBP) in Drosophila S3 cells and its application as a model for studying inositol phosphate signalling through ITPK1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22308441 2012 Regulation of inositol 1,3,4-trisphosphate 5/6-kinase (ITPK1) by reversible lysine acetylation.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
17616525 2007 Integration of inositol phosphate signaling pathways via human ITPK1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15837423 2005 Specificity determinants in inositol polyphosphate synthesis: crystal structure of inositol 1,3,4-trisphosphate 5/6-kinase.
15762844 2005 The Ins(1,3,4)P3 5/6-kinase/Ins(3,4,5,6)P4 1-kinase is not a protein kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12925536 2003 Inositol 1,3,4-trisphosphate 5/6-kinase inhibits tumor necrosis factor-induced apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12324474 2002 Inositol 1,3,4-trisphosphate 5/6-kinase associates with the COP9 signalosome by binding to CSN1.
11909533 2002 Regulation of Ins(3,4,5,6)P(4) signaling by a reversible kinase/phosphatase.
11533064 2001 Inositol 1,3,4-trisphosphate 5/6-kinase is a protein kinase that phosphorylates the transcription factors c-Jun and ATF-2.
11042108 2000 Multitasking in signal transduction by a promiscuous human Ins(3,4,5,6)P(4) 1-kinase/Ins(1,3,4)P(3) 5/6-kinase.
8662638 1996 Isolation of inositol 1,3,4-trisphosphate 5/6-kinase, cDNA cloning and expression of the recombinant enzyme.