Property Summary

NCBI Gene PubMed Count 100
PubMed Score 331.95
PubTator Score 169.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 1.8e-04
glioblastoma 1.200 8.0e-04
lung cancer 1.600 6.1e-04

Gene RIF (96)

PMID Text
26670100 The association of IL28B and APOH single nucleotide polymorphisms (SNPs) with sustained virological response and of ITPA SNPs with anemia related phenotypes.
26438033 polymorphisms increase the likelihood of developing hemolytic anemia for HCV-infected patients on RBV-based therapy, particularly rs1127354 CC and rs7270101 AA genotypes [meta-analysis]
26279293 The identification of ITPA protective and SLC29A1 risk genotypes still appears to be a current methodology in Ribavirin dosing during hepatitis C virus therapy with direct acting antiviral agents
26242828 results showed that patients with aberrant ITPase genotype (mutant homozygous or heterozygous), more likely to be myelosuppressed and show liver toxicity after treatment with 6-Mercaptopurine
26224535 Recessive ITPA mutations were associated with early infantile encephalopathy.
26223482 Hyperbilirubinemia develops at early time points after simeprevir administration in most cases and is dependent on the ITPA genotype.
26154744 ITPA SNPs in Brazilian patients receiving antiviral therapy for chronic hepatitis had a great propensity for developing ribavirin-induced anaemia.
26104535 Genetic variants in inosine triphosphatase (ITPA) gene have been linked to the haemolytic anaemia induced by peg-interferon and ribavirin treatment.
26030972 The significant association was found between the rs1127354 ITPA gene polymorphism and protection against ribavirin-induced hemolytic anemia in the Ukrainian patients with chronic hepatitis C infection.
25743001 Partial splenic embolism, in conjunction with triple combination therapy, is a useful and safe method to treat genotype 1b chronic hepatitis C patients with hypersplenism-induced thrombocytopenia
25713999 Results indicate a strong, significant, and independent role of VDR in the early development of ribavirin-induced anemia and confirm the ITPA function in the prediction of anemia at week 4.
25340831 ITPA polymorphisms are associated with an improved likelihood of achieving sustained virological response resulting from the reduced risk of relapse following IFN and ribavirin combination therapy for HCV infection
25303517 ITPA genotype may serve as a genetic marker for the improvement of risk stratification and therapy individualization for patients with acute lymphoblastic leukemia.
25287171 The ITPA SNP rs1127354 is a useful predictor of ribavirin-induced anemia in Taiwanese patients and may be related to more severe decreases in platelet counts during the early stage of HCV combination therapy.
25240429 genotyping of ATIC rs2372536 and ITPA rs1127354 variants or measuring ITPA activity could be useful to predict methotrexate response in children with juvenile idiopathic arthritis.
25120852 the risk of mercaptopurine intolerance was decreased in acute lymphoblastic leukemia patients with 138 allele and 561 allele polymorphism in the ITPA gene
24774509 For ITPA, the frequency of P32T allele was 3%. We did not observe any homozygous variant for TPMT and ITPA alleles.
24760000 Results show that in patients with F3-F4 chronic hepatitis C receiving telaprevir based therapy, ITPA genotype does not impact on the management of early anemia.
24659876 important role in hepatitis C virus infection[review]
24519039 ITPA variants are associated with reduced risk of hepatitis C relapse.
24449403 ITPA protects against ribavirin-induced anemia, but is not associated with sustained virological response rate.
23960450 Non-CC at rs1127354 without involvement of rs7270101 is strongly associated with protection from ribavirin-induced anemia, however, inosine triphosphatase genotype is not associated with sustained virologic response.
23933495 All ITPA polymorphisms considered were shown to be significantly associated with anemia onset in chronic hepatitis C treated patients.
23850877 Irrespective of the protective effect of ITPA mutations, premenopausal females less likely develop ribavirin induced anemia.
23770441 role of conserved residues in substrate specificity
23730840 ITPA polymorphisms influenced the degree of anaemia but not thrombocytopenia during therapy of chronic hepatitis C genotype 6 infection.
23547827 Study supports recent studies which point towards an important role for ITPase in cellular surveillance of rogue nucleotides.in hematologic malignancy.
23538996 Rs1127354 ITPA polymorphism plays a decisive role in protecting against treatment-induced anemia and the need for ribavirin dose reduction in Egyptian hepatitis C patients.
23528839 We propose that the dimer of P32T variant subunit with wild-type subunit is degraded in cells similarly to the P32T homodimer explaining the level of loss of ITPA activity in heterozygotes.
23301546 IL-28B polymorphisms and ITPA variants influence outcome of treatment for chronic hepatitis C with Peg-Interferon and ribavirin.
23195617 association between ribavirin (RBV) serum levels and SLC28A2 rs11854484 genotype, as well as the replicated association of ITPA and SLC28A3 genetic polymorphisms with RBV-induced anemia and treatment response
23139603 ITPA SNPs influence ribavirin-induced anemia in chronic hepatitis C.
23126166 ITPase C94A has been recognized in about 15% of Japanese bur recent studies on its relationship with thiopurine toxicity has not been clarified.
22585729 ITPA deficiency was associated with slower hemoglobin decline early in treatment (week 4, P = 0.020) and rapid virologic response (RVR) at week 4 (P = 0.017) in patients coinfected with HIV and hepatitis C virus.
22584257 We have confirmed a strong association between functional ITPA variants and Ribavirin-induced hemolysis and showed protection from RBV dose reduction.
22554247 patients with the ITPA-CC genotype showed a smaller decrease in platelet counts during natural interferon-beta/ribavirin combination therapy.
22460221 an association was found between ITPA SNP genotype and treatment-induced anemia during a 4-week course of ribavirin monotherapy in patients with chronic hepatitis C
22430973 Polymorphisms at rs1127354 in the ITPA gene influence hemoglobin levels during combination HCV therapy and the need for RBV dose reduction and erythropoietin use in HIV/HCV-coinfected patients.
22384212 inosine triphosphate pyrophosphatase has a pivotal role in maintaining genome stability and the prevention of apoptosis in human cells
22272297 Results suggest that long-term effects of HIV-infection altering ITPase protein expression or stability.
22225964 This study provides the first analysis of ITPA mutant allele frequency in individuals of Tunisian origin
22189977 Relative to HCV infection,ITPA is a gene on chromosome 20, coding for inosine triphosphatase, and polymorphisms on this gene have been associated with ribavirin-induced hemolytic anemia [review]
22060550 The study shows the effect of ITPA polymorphisms on the handling of inosine triphosphate and thioinosine triphosphate.
22052220 There were no significant differences in virological responses of HCV-RNA between patients with the ITPA major allele and those with the minor allele.
21817190 variants could protect against hemolytic anemia + RBV dose reuctn, assoc w/ high rate response if TT genotype @ rs8099917 of IL28b
21612542 The inosine triphosphatase genotype appear to be strongly associated with differental risk of rivabirin-induced HA and, consequently, of ribavirin dose reduction.
21246582 Polymorphisms of the inosine triphosphatase (ITPA) gene influence anemia during pegylated interferon (PEG-IFN) and ribavirin (RBV) therapy.
20977565 Observational study of gene-disease association. (HuGE Navigator)
20930204 ITPA variants may have a role in the clinical course of pulmonary Langerhans' cell histiocytosis
20637204 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20547162 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20393862 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20308917 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20173735 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20045992 Observational study of genotype prevalence. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19914375 Amino acid substituted ITPase is a functional protein, with a reduced rate of NTP pyrophosphohydrolase activity and protein stability.
19858780 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19682085 The present study is the first to reveal the bimodal distribution of ITPA activity in Chinese patients with renal transplantation and 94C>A polymorphism.
19682085 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19631656 Data suggest that the P32T mutation of triphosphate pyrophosphatase exerts its effect in certain human tissues by cumulative effects of destabilization of transcripts, protein stability, and availability.
19579612 Adverse reactions to thiopurines in IBD may be predisposed by thiopurine methyltransferase (TPMT) or inosine triphosphate pyrophosphatase (ITPA) gene mutations. 87T>C and IVS2+53C>T were novel single nucleotide polymorphisms of the ITPA gene.
19229528 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19214663 It is suggested that the ITPA gene mutation is closely related to adverse reactions of AZA/6-MP in Japanese patients, and screening for the mutant allele is useful for predicting the most serious adverse reactions
19214663 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19193698 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19129747 Observational study of gene-disease association. (HuGE Navigator)
18823306 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18685564 Genetic polymorphism of inosine triphosphate pyrophosphatase (ITPA) is a significant determinant of mercaptopurine metabolism and neutropenia in acute lymphoblastic leukemia patients.
18685564 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18240903 Observational study of genotype prevalence. (HuGE Navigator)
18223458 There was no evidence for functional promoter SNPs, and it is suggested that only SNPs within the very proximal promoter region (approximately 200 bp) have the potential to be functionally significant.
17697198 Meta-analysis of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17530705 Observational study of gene-disease association, pharmacogenomic / toxicogenomic, and genetic testing. (HuGE Navigator)
17304144 Observational study of gene-disease association. (HuGE Navigator)
17304144 distribution of ITPA activity, types & frequencies of gene variants associated with lower enzyme activity were determined in a Bulgarian population; a novel frameshift mutation 359_366dupTCAGCACC in exon 6 found in a subject with reduced enzyme activity
17138556 ITPA deficiency mutation P32T leads to a shift of this loop that results in a disturbed affinity for nucleotides and/or a reduced catalytic activity in both monomers of the physiological dimer.
17113761 The ITPA c.94C>A allelic variant destroys an exonic splicing silencing (ESS) element in exon 2 causing activation of two nearby upstream 5' splice sites and missplicing of exons 2 and 3 cassette causing structural changes contributing to ITPase deficiency
17077483 cocrystallization of ITPA with a molar ratio of XTP appears to have improved the crystals by eliminating twinning and resulted in an orthorhombic space group.
16947783 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16611274 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16431304 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16214825 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15973722 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15973722 TPMT, ITPA, and MTHFR genotypes do not predict adverse drug reactions, including bone marrow suppression, in liver transplant patients.
15946879 Observational study of genotype prevalence. (HuGE Navigator)
15571266 Observational study of genotype prevalence. (HuGE Navigator)
15571266 analysis of blood samples reveals ITPase gene polymorphisms in a Japanese population
15571265 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15571265 ITPA 94C>A deficiency-associated allele has a role in response to azathioprine in inflammatory bowel disease to
15564886 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15322947 Observational study of genotype prevalence. (HuGE Navigator)
15167706 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12436200 Observational study of gene-disease association. (HuGE Navigator)
12436200 Sequencing of the genomic DNA from a subject with complete ITP-ase deficiency revealed homozygosity for missense mutation 198C>A.
1667585 putative interaction based on report showing inhibition of nucleoside triphosphatase by Rev in mouse cells

AA Sequence

MAASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLV      1 - 70
EDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRI     71 - 140
VAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAA                    141 - 194
//

Text Mined References (102)

PMID Year Title
26670100 2015 Impact of IL28B, APOH and ITPA Polymorphisms on Efficacy and Safety of TVR- or BOC-Based Triple Therapy in Treatment-Experienced HCV-1 Patients with Compensated Cirrhosis from the ANRS CO20-CUPIC Study.
26438033 2015 Relationship between ITPA polymorphisms and hemolytic anemia in HCV-infected patients after ribavirin-based therapy: a meta-analysis.
26279293 2015 ITPA and SLC29A1 Genotyping for the Prediction of Ribavirin Dose Reduction in Anti-HCV Triple Therapy with Protease Inhibitors.
26242828 2015 Frequency of ITPA gene polymorphisms in Iranian patients with acute lymphoblastic leukemia and prediction of its myelosuppressive effects.
26224535 2015 Recessive ITPA mutations cause an early infantile encephalopathy.
26223482 2016 The impact of an inosine triphosphate pyrophosphatase genotype on bilirubin increase in chronic hepatitis C patients treated with simeprevir, pegylated interferon plus ribavirin.
26154744 2015 Inosine triphosphatase allele frequency and association with ribavirin-induced anaemia in Brazilian patients receiving antiviral therapy for chronic hepatitis C.
26104535 2016 Protease inhibitors-based therapy induces acquired spherocytic-like anaemia and ineffective erythropoiesis in chronic hepatitis C virus patients.
26030972 ITPA gene variant may protect against anemia induced during pegylated interferon alfa and ribavirin combination treatment in Ukrainian patients with chronic hepatitis C.
25743001 2015 Safety and efficacy of partial splenic embolization in telaprevir-based triple therapy for chronic hepatitis C.
25713999 2015 VDR gene polymorphisms impact on anemia at 2 weeks of anti-HCV therapy: a possible mechanism for early RBV-induced anemia.
25340831 2014 Do variations in the ITPA gene determine the risk of hepatitis C virus relapse?
25303517 2014 Association of ITPA genotype with event-free survival and relapse rates in children with acute lymphoblastic leukemia undergoing maintenance therapy.
25287171 2015 Association between IPTA gene polymorphisms and hematological abnormalities in hepatitis C virus-infected patients receiving combination therapy.
25240429 2015 5-Aminoimidazole-4-carboxamide ribonucleotide-transformylase and inosine-triphosphate-pyrophosphatase genes variants predict remission rate during methotrexate therapy in patients with juvenile idiopathic arthritis.
25120852 2014 Inosine triphosphate pyrophosphohydrolase (ITPA) polymorphic sequence variants in Chinese ALL children and possible association with mercaptopurine related toxicity.
24774509 2014 Prevalence of TPMT and ITPA gene polymorphisms and effect on mercaptopurine dosage in Chilean children with acute lymphoblastic leukemia.
24760000 2014 Limited utility of ITPA deficiency to predict early anemia in HCV patients with advanced fibrosis receiving Telaprevir.
24659876 2014 Individualization of chronic hepatitis C treatment according to the host characteristics.
24519039 2014 Variants of the inosine triphosphate pyrophosphatase gene are associated with reduced relapse risk following treatment for HCV genotype 2/3.
24449403 2014 ITPA genotype protects against anemia during peginterferon and ribavirin therapy but does not influence virological response.
23960450 2013 The impact of inosine triphosphatase variants on hemoglobin level and sustained virologic response of chronic hepatitis C in Korean.
23933495 2013 Association of ITPA polymorphisms rs6051702/rs1127354 instead of rs7270101/rs1127354 as predictor of ribavirin-associated anemia in chronic hepatitis C treated patients.
23850877 2013 Effect of gender and ITPA polymorphisms on ribavirin-induced anemia in chronic hepatitis C patients.
23770441 2013 Analysis of human ITPase nucleobase specificity by site-directed mutagenesis.
23730840 2013 Role of IL28B and inosine triphosphatase polymorphisms in the treatment of chronic hepatitis C virus genotype 6 infection.
23547827 2013 Inosine triphosphate pyrophosphohydrolase (ITPA) polymorphic sequence variants in adult hematological malignancy patients and possible association with mitochondrial DNA defects.
23538996 2013 Pre-treatment role of inosine triphosphate pyrophosphatase polymorphism for predicting anemia in Egyptian hepatitis C virus patients.
23528839 2013 The human ITPA polymorphic variant P32T is destabilized by the unpacking of the hydrophobic core.
23301546 2013 Role of IL-28B and inosine triphosphatase polymorphisms in efficacy and safety of Peg-Interferon and ribavirin in chronic hepatitis C compensated cirrhosis with and without oesophageal varices.
23195617 2013 Impact of genetic SLC28 transporter and ITPA variants on ribavirin serum level, hemoglobin drop and therapeutic response in patients with HCV infection.
23139603 2012 Several factors including ITPA polymorphism influence ribavirin-induced anemia in chronic hepatitis C.
23126166 2012 [Genetic factors affecting elevated thiopurine sensitivity in Japanese patients with inflammatory bowel disease].
22585729 2012 ITPA gene polymorphisms significantly affect hemoglobin decline and treatment outcomes in patients coinfected with HIV and HCV.
22584257 2012 Genetic variants at the ITPA locus protect against ribavirin-induced hemolytic anemia and dose reduction in an HCV G2/G3 cohort.
22554247 2012 Increase in platelet count based on inosine triphosphatase genotype during interferon beta plus ribavirin combination therapy.
22460221 2012 Anemia and thrombocytosis induced by ribavirin monotherapy in patients with chronic hepatitis C.
22430973 2012 Association of ITPA gene polymorphisms and the risk of ribavirin-induced anemia in HIV/hepatitis C virus (HCV)-coinfected patients receiving HCV combination therapy.
22384212 2012 Pivotal role of inosine triphosphate pyrophosphatase in maintaining genome stability and the prevention of apoptosis in human cells.
22272297 2012 Erythrocyte inosine triphosphatase activity is decreased in HIV-seropositive individuals.
22225964 2012 Allele frequency of inosine triphosphate pyrophosphatase (ITPA) and thiopurine-S-methyl transferase (TPMT) genes in the Tunisian population.
22189977 2011 The impact of human gene polymorphisms on HCV infection and disease outcome.
22060550 2011 The effect of ITPA polymorphisms on the enzyme kinetic properties of human erythrocyte inosine triphosphatase toward its substrates ITP and 6-Thio-ITP.
22052220 2012 Polymorphism of the inosine triphosphate pyrophosphatase gene predicts ribavirin-induced anemia in chronic hepatitis C patients.
21817190 2011 Relationship between polymorphisms of the inosine triphosphatase gene and anaemia or outcome after treatment with pegylated interferon and ribavirin.
21703177 2012 Genome-wide association study of interferon-related cytopenia in chronic hepatitis C patients.
21659334 2011 Genome-wide association study identified ITPA/DDRGK1 variants reflecting thrombocytopenia in pegylated interferon and ribavirin therapy for chronic hepatitis C.
21612542 2011 Translating pharmacogenetics into clinical practice: interleukin (IL)28B and inosine triphosphatase (ITPA) polymophisms in hepatitis C virus (HCV) infection.
21269460 2011 Initial characterization of the human central proteome.
21246582 2011 Influence of ITPA polymorphisms on decreases of hemoglobin during treatment with pegylated interferon, ribavirin, and telaprevir.
20977565 2010 ITPA gene variant protects against anemia induced by pegylated interferon-? and ribavirin therapy for Japanese patients with chronic hepatitis C.
20930204 2010 A role for ITPA variants in the clinical course of pulmonary Langerhans' cell histiocytosis?
20637204 2010 ITPA polymorphism affects ribavirin-induced anemia and outcomes of therapy--a genome-wide study of Japanese HCV virus patients.
20547162 2010 Variants in the ITPA gene protect against ribavirin-induced hemolytic anemia and decrease the need for ribavirin dose reduction.
20393862 2010 The multidrug-resistance protein 4 polymorphism is a new factor accounting for thiopurine sensitivity in Japanese patients with inflammatory bowel disease.
20308917 Influences of thiopurine methyltransferase genotype and activity on thiopurine-induced leukopenia in Korean patients with inflammatory bowel disease: a retrospective cohort study.
20173735 2010 ITPA gene variants protect against anaemia in patients treated for chronic hepatitis C.
20045992 2009 Genetic variations in the HGPRT, ITPA, IMPDH1, IMPDH2, and GMPS genes in Japanese individuals.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19914375 2010 Quantitative in vitro and in vivo characterization of the human P32T mutant ITPase.
19858780 2009 Gene-gene interactions in folate and adenosine biosynthesis pathways affect methotrexate efficacy and tolerability in rheumatoid arthritis.
19682085 2010 Association between inosine triphosphate pyrophosphohydrolase deficiency and azathioprine-related adverse drug reactions in the Chinese kidney transplant recipients.
19631656 2009 Functional study of the P32T ITPA variant associated with drug sensitivity in humans.
19579612 Allele frequency of thiopurine methyltransferase and inosine triphosphate pyrophosphatase gene polymorphisms in Korean patients with inflammatory bowel diseases.
19229528 2009 TPMT but not ITPA gene polymorphism influences the risk of azathioprine intolerance in renal transplant recipients.
19214663 2009 Thiopurine S-methyltransferase and inosine triphosphate pyrophosphohydrolase genes in Japanese patients with inflammatory bowel disease in whom adverse drug reactions were induced by azathioprine/6-mercaptopurine treatment.
19193698 2009 Investigation of candidate polymorphisms and disease activity in rheumatoid arthritis patients on methotrexate.
19129747 2009 Pro32Thr polymorphism of inosine triphosphate pyrophosphatase gene predicts efficacy of low-dose azathioprine for patients with systemic lupus erythematosus.
18823306 2008 Population pharmacokinetic and pharmacogenetic analysis of 6-mercaptopurine in paediatric patients with acute lymphoblastic leukaemia.
18685564 2009 Genetic polymorphism of inosine triphosphate pyrophosphatase is a determinant of mercaptopurine metabolism and toxicity during treatment for acute lymphoblastic leukemia.
18240903 2007 Pharmacogenetically relevant polymorphisms in Portugal.
18223458 2008 Characterization of the inosine triphosphatase (ITPA) gene: haplotype structure, haplotype-phenotype correlation and promoter function.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17697198 2007 Meta-analysis: Inosine triphosphate pyrophosphatase polymorphisms and thiopurine toxicity in the treatment of inflammatory bowel disease.
17530705 2007 A clinical pharmacogenetic model to predict the efficacy of methotrexate monotherapy in recent-onset rheumatoid arthritis.
17304144 2007 Analysis of ITPA phenotype-genotype correlation in the Bulgarian population revealed a novel gene variant in exon 6.
17138556 2007 Crystal structure of human inosine triphosphatase. Substrate binding and implication of the inosine triphosphatase deficiency mutation P32T.
17113761 2007 The ITPA c.94C>A and g.IVS2+21A>C sequence variants contribute to missplicing of the ITPA gene.
17090528 2007 Substrate specificity of RdgB protein, a deoxyribonucleoside triphosphate pyrophosphohydrolase.
17077483 2006 Structure of the orthorhombic form of human inosine triphosphate pyrophosphatase.
16947783 2006 Relationship between genetic variants in the adenosine pathway and outcome of methotrexate treatment in patients with recent-onset rheumatoid arthritis.
16611274 2006 Pharmacogenetics of thiopurine therapy in paediatric IBD patients.
16431304 2006 Inosine triphosphate pyrophosphatase and thiopurine s-methyltransferase genotypes relationship to azathioprine-induced myelosuppression.
16214825 2005 Association of inosine triphosphatase 94C>A and thiopurine S-methyltransferase deficiency with adverse events and study drop-outs under azathioprine therapy in a prospective Crohn disease study.
15973722 2005 Pharmacogenetic association with adverse drug reactions to azathioprine immunosuppressive therapy following liver transplantation.
15946879 2005 Genetic basis of inosine triphosphate pyrophosphohydrolase deficiency in the Japanese population.
15571266 2004 Allele frequency of inosine triphosphate pyrophosphatase gene polymorphisms in a Japanese population.
15571265 2004 Mutation in the ITPA gene predicts intolerance to azathioprine.
15564886 2004 Lack of association between the ITPA 94C>A polymorphism and adverse effects from azathioprine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15322947 2004 Distribution of ITPA P32T alleles in multiple world populations.
15167706 2004 Adverse drug reactions to azathioprine therapy are associated with polymorphism in the gene encoding inosine triphosphate pyrophosphatase (ITPase).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12436200 2002 DNA polymorphisms in ITPA including basis of inosine triphosphatase deficiency.
12384777 2002 Genetic basis of inosine triphosphate pyrophosphohydrolase deficiency.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11278832 2001 Cloning, expression, and characterization of a human inosine triphosphate pyrophosphatase encoded by the itpa gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1667585 1991 Interaction of human immunodeficiency virus type I Rev protein with nuclear scaffold nucleoside triphosphatase activity.
1204209 1975 Individual variation in inosine triphosphate accumulation in human erythrocytes.
487601 1979 Human inosine triphosphatase: catalytic properties and population studies.