Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.63
PubTator Score 6.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple myeloma 1.836 2.3e-02
psoriasis -2.100 6.2e-08
medulloblastoma, large-cell -1.800 1.3e-04
ulcerative colitis 1.200 2.4e-03
Duchenne muscular dystrophy 1.636 9.0e-05
autosomal dominant Emery-Dreifuss muscul... 1.446 3.1e-02
adrenocortical carcinoma -1.478 7.6e-03
non-small cell lung cancer -2.316 1.4e-17
intraductal papillary-mucinous neoplasm ... -1.800 4.9e-02
colon cancer -2.300 1.3e-02
lung cancer -4.200 8.9e-07
active Crohn's disease 1.405 4.1e-02
sarcoidosis 1.600 3.7e-03
breast carcinoma -2.300 1.2e-41
lung adenocarcinoma -2.200 1.5e-11
pilocytic astrocytoma 1.200 1.8e-03
invasive ductal carcinoma -2.800 1.6e-03
severe Alzheimer's disease -1.108 3.4e-02
Breast cancer -3.500 4.1e-19
lung carcinoma -1.500 5.0e-08
mucosa-associated lymphoid tissue lympho... -1.065 1.4e-02
ductal carcinoma in situ -1.500 2.6e-03
ovarian cancer -3.300 1.6e-09
pituitary cancer -1.900 1.4e-04

Gene RIF (5)

PMID Text
26691219 ITM2A is a new biomarker of poor prognosis in ovarian cancer and a novel tumor suppressor that induces cell cycle arrest, acts as a chemosensitizer, and has therapeutic potential for ovarian cancer.
26125709 The upregulated gene with the largest effect size in ankylosing spondylitis was ITM2A, which plays a role in activation of T cells. (Meta-analysis)
25951193 ITM2A expression is positively regulated by PKA-CREB signaling and ITM2A expression interferes with autophagic flux by interacting with vacuolar ATPase.
24516404 our results show one of the first links between phenotypic variation in a population sample and an XCI-escaping locus and pinpoint ITM2A as a potential contributor to the sexual dimorphism in height
19541402 Enhanced ITM2A expression inhibits chondrogenic differentiation of mesenchymal stem cells.

AA Sequence

MVKIAFNTPTAVQKEEARQDVEALLSRTVRTQILTGKELRVATQEKEGSSGRCMLTLLGLSFILAGLIVG      1 - 70
GACIYKYFMPKSTIYRGEMCFFDSEDPANSLRGGEPNFLPVTEEADIREDDNIAIIDVPVPSFSDSDPAA     71 - 140
IIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELFGKLASGRYLPQTYVVREDLVAVEEIRDVSN    141 - 210
LGIFIYQLCNNRKSFRLRRRDLLLGFNKRAIDKCWKIRHFPNEFIVETKICQE                     211 - 263
//

Text Mined References (23)

PMID Year Title
26691219 2016 Loss of ITM2A, a novel tumor suppressor of ovarian cancer through G2/M cell cycle arrest, is a poor prognostic factor of epithelial ovarian cancer.
26125709 2015 Meta-analysis of differentially expressed genes in ankylosing spondylitis.
25951193 2015 The integral membrane protein ITM2A, a transcriptional target of PKA-CREB, regulates autophagic flux via interaction with the vacuolar ATPase.
25416956 2014 A proteome-scale map of the human interactome network.
24516404 2014 Chromosome X-wide association study identifies Loci for fasting insulin and height and evidence for incomplete dosage compensation.
23612905 2013 Robust evidence for five new Graves' disease risk loci from a staged genome-wide association analysis.
19541402 Enhanced ITM2A expression inhibits chondrogenic differentiation of mesenchymal stem cells.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15983050 2005 The familial dementia BRI2 gene binds the Alzheimer gene amyloid-beta precursor protein and inhibits amyloid-beta production.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10432285 1999 ITM2A is induced during thymocyte selection and T cell activation and causes downregulation of CD8 when overexpressed in CD4(+)CD8(+) double positive thymocytes.
9892734 1999 Genomic organization and chromosomal localization of the Itm2a gene.
9653160 1998 Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.
8702637 1996 Isolation of markers for chondro-osteogenic differentiation using cDNA library subtraction. Molecular cloning and characterization of a gene belonging to a novel multigene family of integral membrane proteins.
8570611 1996 Analysis of differential gene expression by display of 3' end restriction fragments of cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.