| Tbio | Integral membrane protein 2A |
This gene encodes a type II membrane protein that belongs to the ITM2 family. Studies in mouse suggest that it may be involved in osteo- and chondrogenic differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]
Comments
| Disease | Target Count |
|---|---|
| Peripheral Neuropathy | 303 |
| Disease | Target Count | P-value |
|---|---|---|
| breast carcinoma | 1614 | 1.2e-41 |
| Breast cancer | 3098 | 4.1e-19 |
| non-small cell lung cancer | 2798 | 1.4e-17 |
| lung adenocarcinoma | 2714 | 1.5e-11 |
| ovarian cancer | 8491 | 1.6e-09 |
| lung carcinoma | 2844 | 5.0e-08 |
| psoriasis | 6685 | 6.2e-08 |
| lung cancer | 4473 | 8.9e-07 |
| Duchenne muscular dystrophy | 602 | 9.0e-05 |
| medulloblastoma, large-cell | 6234 | 1.3e-04 |
| pituitary cancer | 1972 | 1.4e-04 |
| invasive ductal carcinoma | 2950 | 1.6e-03 |
| pilocytic astrocytoma | 3086 | 1.8e-03 |
| ulcerative colitis | 2087 | 2.4e-03 |
| ductal carcinoma in situ | 1745 | 2.6e-03 |
| sarcoidosis | 368 | 3.7e-03 |
| adrenocortical carcinoma | 1427 | 7.6e-03 |
| colon cancer | 1475 | 1.3e-02 |
| mucosa-associated lymphoid tissue lymphoma | 480 | 1.4e-02 |
| Multiple myeloma | 1327 | 2.3e-02 |
| autosomal dominant Emery-Dreifuss muscular dystrophy | 499 | 3.1e-02 |
| severe Alzheimer's disease | 49 | 3.4e-02 |
| active Crohn's disease | 918 | 4.1e-02 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 4.9e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| X-linked nonsyndromic deafness | 10 | 4.29 | 2.1 |
| Mononeuropathy | 3 | 3.113 | 1.6 |
| Disease | log2 FC | p |
|---|---|---|
| Multiple myeloma | 1.836 | 2.3e-02 |
| psoriasis | -2.100 | 6.2e-08 |
| medulloblastoma, large-cell | -1.800 | 1.3e-04 |
| ulcerative colitis | 1.200 | 2.4e-03 |
| Duchenne muscular dystrophy | 1.636 | 9.0e-05 |
| autosomal dominant Emery-Dreifuss muscul... | 1.446 | 3.1e-02 |
| adrenocortical carcinoma | -1.478 | 7.6e-03 |
| non-small cell lung cancer | -2.316 | 1.4e-17 |
| intraductal papillary-mucinous neoplasm ... | -1.800 | 4.9e-02 |
| colon cancer | -2.300 | 1.3e-02 |
| lung cancer | -4.200 | 8.9e-07 |
| active Crohn's disease | 1.405 | 4.1e-02 |
| sarcoidosis | 1.600 | 3.7e-03 |
| breast carcinoma | -2.300 | 1.2e-41 |
| lung adenocarcinoma | -2.200 | 1.5e-11 |
| pilocytic astrocytoma | 1.200 | 1.8e-03 |
| invasive ductal carcinoma | -2.800 | 1.6e-03 |
| severe Alzheimer's disease | -1.108 | 3.4e-02 |
| Breast cancer | -3.500 | 4.1e-19 |
| lung carcinoma | -1.500 | 5.0e-08 |
| mucosa-associated lymphoid tissue lympho... | -1.065 | 1.4e-02 |
| ductal carcinoma in situ | -1.500 | 2.6e-03 |
| ovarian cancer | -3.300 | 1.6e-09 |
| pituitary cancer | -1.900 | 1.4e-04 |
| PMID | Text | |
|---|---|---|
| 26691219 | ITM2A is a new biomarker of poor prognosis in ovarian cancer and a novel tumor suppressor that induces cell cycle arrest, acts as a chemosensitizer, and has therapeutic potential for ovarian cancer. | |
| 26125709 | The upregulated gene with the largest effect size in ankylosing spondylitis was ITM2A, which plays a role in activation of T cells. (Meta-analysis) | |
| 25951193 | ITM2A expression is positively regulated by PKA-CREB signaling and ITM2A expression interferes with autophagic flux by interacting with vacuolar ATPase. | |
| 24516404 | our results show one of the first links between phenotypic variation in a population sample and an XCI-escaping locus and pinpoint ITM2A as a potential contributor to the sexual dimorphism in height | |
| 19541402 | Enhanced ITM2A expression inhibits chondrogenic differentiation of mesenchymal stem cells. |
MVKIAFNTPTAVQKEEARQDVEALLSRTVRTQILTGKELRVATQEKEGSSGRCMLTLLGLSFILAGLIVG 1 - 70 GACIYKYFMPKSTIYRGEMCFFDSEDPANSLRGGEPNFLPVTEEADIREDDNIAIIDVPVPSFSDSDPAA 71 - 140 IIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELFGKLASGRYLPQTYVVREDLVAVEEIRDVSN 141 - 210 LGIFIYQLCNNRKSFRLRRRDLLLGFNKRAIDKCWKIRHFPNEFIVETKICQE 211 - 263 //
| PMID | Year | Title | |
|---|---|---|---|
| 26691219 | 2016 | Loss of ITM2A, a novel tumor suppressor of ovarian cancer through G2/M cell cycle arrest, is a poor prognostic factor of epithelial ovarian cancer. | |
| 26125709 | 2015 | Meta-analysis of differentially expressed genes in ankylosing spondylitis. | |
| 25951193 | 2015 | The integral membrane protein ITM2A, a transcriptional target of PKA-CREB, regulates autophagic flux via interaction with the vacuolar ATPase. | |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 24516404 | 2014 | Chromosome X-wide association study identifies Loci for fasting insulin and height and evidence for incomplete dosage compensation. | |
| 23612905 | 2013 | Robust evidence for five new Graves' disease risk loci from a staged genome-wide association analysis. | |
| 19541402 | Enhanced ITM2A expression inhibits chondrogenic differentiation of mesenchymal stem cells. | ||
| 18391951 | 2008 | Many sequence variants affecting diversity of adult human height. | |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15983050 | 2005 | The familial dementia BRI2 gene binds the Alzheimer gene amyloid-beta precursor protein and inhibits amyloid-beta production. | |
| 15772651 | 2005 | The DNA sequence of the human X chromosome. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12975309 | 2003 | The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11042152 | 2000 | Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. | |
| 10432285 | 1999 | ITM2A is induced during thymocyte selection and T cell activation and causes downregulation of CD8 when overexpressed in CD4(+)CD8(+) double positive thymocytes. | |
| 9892734 | 1999 | Genomic organization and chromosomal localization of the Itm2a gene. | |
| 9653160 | 1998 | Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning. | |
| 8702637 | 1996 | Isolation of markers for chondro-osteogenic differentiation using cDNA library subtraction. Molecular cloning and characterization of a gene belonging to a novel multigene family of integral membrane proteins. | |
| 8570611 | 1996 | Analysis of differential gene expression by display of 3' end restriction fragments of cDNAs. | |
| 8125298 | 1994 | Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides. |
