Tbio | Integral membrane protein 2A |
This gene encodes a type II membrane protein that belongs to the ITM2 family. Studies in mouse suggest that it may be involved in osteo- and chondrogenic differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]
Comments
Disease | Target Count | P-value |
---|---|---|
Breast cancer | 3578 | 4.1e-19 |
non-small cell lung cancer | 2890 | 1.4e-17 |
lung adenocarcinoma | 2716 | 9.7e-11 |
ovarian cancer | 8520 | 1.6e-09 |
lung carcinoma | 2843 | 5.0e-08 |
psoriasis | 6694 | 6.2e-08 |
breast carcinoma | 1638 | 8.3e-05 |
Duchenne muscular dystrophy | 601 | 9.0e-05 |
lung cancer | 4740 | 1.1e-04 |
invasive ductal carcinoma | 2951 | 1.1e-04 |
medulloblastoma, large-cell | 6241 | 1.3e-04 |
pituitary cancer | 1972 | 1.4e-04 |
Astrocytoma, Pilocytic | 3081 | 1.7e-03 |
sarcoidosis | 370 | 3.7e-03 |
adrenocortical carcinoma | 1428 | 7.6e-03 |
ductal carcinoma in situ | 1745 | 1.2e-02 |
colon cancer | 1478 | 1.3e-02 |
ulcerative colitis | 1819 | 1.4e-02 |
mucosa-associated lymphoid tissue lymphoma | 484 | 1.4e-02 |
Multiple myeloma | 1332 | 2.3e-02 |
autosomal dominant Emery-Dreifuss muscular dystrophy | 510 | 3.1e-02 |
severe Alzheimer's disease | 47 | 3.4e-02 |
active Crohn's disease | 922 | 4.1e-02 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 4.9e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
X-linked nonsyndromic deafness | 12 | 4.187 | 2.1 |
Mononeuropathy | 1 | 3.058 | 1.5 |
Disease | log2 FC | p |
---|---|---|
active Crohn's disease | 1.405 | 4.1e-02 |
adrenocortical carcinoma | -1.478 | 7.6e-03 |
Astrocytoma, Pilocytic | 1.200 | 1.7e-03 |
autosomal dominant Emery-Dreifuss muscul... | 1.446 | 3.1e-02 |
Breast cancer | -3.500 | 4.1e-19 |
breast carcinoma | -1.700 | 8.3e-05 |
colon cancer | -2.300 | 1.3e-02 |
Duchenne muscular dystrophy | 1.636 | 9.0e-05 |
ductal carcinoma in situ | -1.300 | 1.2e-02 |
intraductal papillary-mucinous neoplasm ... | -1.800 | 4.9e-02 |
invasive ductal carcinoma | -1.966 | 1.1e-04 |
lung adenocarcinoma | -1.400 | 9.7e-11 |
lung cancer | -2.400 | 1.1e-04 |
lung carcinoma | -1.500 | 5.0e-08 |
medulloblastoma, large-cell | -1.800 | 1.3e-04 |
mucosa-associated lymphoid tissue lympho... | -1.065 | 1.4e-02 |
Multiple myeloma | 1.836 | 2.3e-02 |
non-small cell lung cancer | -2.316 | 1.4e-17 |
ovarian cancer | -3.300 | 1.6e-09 |
pituitary cancer | -1.900 | 1.4e-04 |
psoriasis | -2.100 | 6.2e-08 |
sarcoidosis | 1.600 | 3.7e-03 |
severe Alzheimer's disease | -1.108 | 3.4e-02 |
ulcerative colitis | -1.125 | 1.4e-02 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
OMA EggNOG |
MVKIAFNTPTAVQKEEARQDVEALLSRTVRTQILTGKELRVATQEKEGSSGRCMLTLLGLSFILAGLIVG 1 - 70 GACIYKYFMPKSTIYRGEMCFFDSEDPANSLRGGEPNFLPVTEEADIREDDNIAIIDVPVPSFSDSDPAA 71 - 140 IIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELFGKLASGRYLPQTYVVREDLVAVEEIRDVSN 141 - 210 LGIFIYQLCNNRKSFRLRRRDLLLGFNKRAIDKCWKIRHFPNEFIVETKICQE 211 - 263 //