Property Summary

NCBI Gene PubMed Count 128
PubMed Score 297.92
PubTator Score 289.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
rhinitis with controlled asthma 2.200 5.0e-02
uncontrolled asthma 4.400 4.8e-04
osteosarcoma -2.182 1.1e-06
pancreatic ductal adenocarcinoma liver m... -1.305 1.8e-03
active Crohn's disease 1.016 2.7e-02
ulcerative colitis 1.900 4.7e-02
lung adenocarcinoma -5.100 4.7e-16
ovarian cancer -10.000 1.8e-38

 GO Function (1)

Gene RIF (115)

PMID Text
26904686 The concentrations of gastric peptide(Ghrelin and obestatin)and adipocytokines(omentin and Apelin ) across all subgroups were lower than in the control group. The differences were statistically significant (p < 0.0001), which may be of importance in the development of the disease complications
26539805 Data show that the circulating omentin-1 levels were dramatically decreased in renal cell carcinoma (RCC) patients.
26514948 Plasma omentin-1 concentrations were decreased in non-obese polycystic ovary syndrome individuals
26466574 Serum omentin was associated with cardiac autonomic neuropathy in type 2 diabetes patients.
26316585 This study clearly indicates that acute aerobic exercise elicits a pro-inflammatory response (e.g. CHI3L1) with a lower anti-inflammatory effect (e.g. ITLN-1) in obese individuals.
26293449 A decrease in omentin-1 levels could be an independent mortality risk factor in patient with diabetes on hemodialysis.
26291814 Omentin levels were lower in both obese and non-obese PCOS patients compared to healthy controls.
26277181 Omentin enhances insulin-stimulated glucose uptake in subcutaneous and visceral adipose tissue. omentin increases phosphorylation of AMP-activated protein kinase, which indicates a potential role of omentin in energy homeostasis.
26148048 Data indicate that none of the intelectin 1 (hIntL-1) ligands identified on the microbial glycan array are found in mammalian glycans.
26144294 analysis of expression of maternal omentin-1 in humans and in the rat animal model
26094489 Data suggest serum omentin/ITLN1 levels are down-regulated in elderly population (ages 61-82 years) with type 2 diabetes and polyneuropathy, independently of established risk factors of polyneuropathy; ITLN1 is positively correlated with adiponectin.
26079253 REVIEW: a concise and general overview on the roles of omentin in cardiovascular diseases; the knowledge of these concepts may provide a new strategy to reduce disease risks on CVD in the future
25980946 In women with osteoporosis and osteopenia, homozygous AA genotype of omentin gene may predispose to lower bone mineral density in the lumbar spine.
25965823 Low Intelectin 1 expression is associated with gastric cancer.
25904298 Plasma omentin level and omentin/resistin ratio were decreased, whereas the resistin and TNF-alpha levels and TNF-alpha/omentin ratio were increased in BD patients.
25889839 Patients with high ITLN1 or NDRG2 expression had greater survival probability.
25804090 The mean serum omentin-1 concentration in adolescent girls with anorexia nervosa was higher than that of controls and obese girls.
25789872 Data show a rather strong relationship between exercise performance and circulating omentin-1 levels as well as an increase of the adipokine in response to 6-week of endurance training in obese women
25733068 Observations further suggest that omentin acts via upregulation of adiponectin, which in turn affects lipid metabolism and thereby also indirectly enhances insulin sensitivity.
25690163 Therefore, omentin-1 may have a role in the pathogenesis of psoriasis and might be a potential biological marker for psoriasis severity.
25576244 serum omentin-1 levels are decreased in patients with inflammatory bowel disease
25479337 Omentin functions to attenuate the pathological process of myocardial hypertrophy.
25453978 The expressions of Adiponectin, visfatin, and omentin were correlated within each type of fat but not between different fat depots
25324439 Circulating maternal omentin levels are correlated with insulin resistance indices.
25300621 fat-specific human omentin transgenic (OMT-TG) mice exhibited reduced neointimal thickening and vascular cell growth following vascular injury
25294287 Suggest a strong association between decreased serum omentin-1 levels and severity of peripheral arterial disease.
25264991 Lower levels of serum omentin in patients with pseudoexfoliation syndrome compared with healthy subjects may support the theory of systemic nature of the disease.
25139582 Omentin levels increased as early as 24-h post-bariatric surgery, with changes maintained up to 1-year.
25060690 Irisin and omentin-1 are stable within-person.
24997770 decreased omentin-1 levels may contribute to the development of insulin resistance, type 2 diabetes mellitus and particularly to obesity in Chinese adults
24943040 The effects of IGF-1 on steroidogenesis via the expression of intelectin-1 and NAMPT in human granulosa-lutein cells are reported.
24918534 Serum Omentin-1 levels in chronic kidney disease (CKD) patients were significantly lower compared to the healthy controls. Further analyze revealed that decreased omentin in CKD patients was due to the reduced omentin levels in the diabetic subgroup.
24912760 Data suggest that serum ITLN1 levels are down-regulated in women with pre-eclampsia as compared to healthy control subjects; thus, serum ITLN1 level may serve as biomarker for diagnosis of pre-eclampsia and index of severity of pre-eclampsia.
24852382 results suggest that plasma omentin levels are decreased in physically healthy, nonobese, antipsychotic-free patients with schizophrenia.
24768874 Systemic administration of human omentin to mice leads to a reduction in myocardial infarct size and apoptosis after ischemia/reperfusion, accompanied by enhanced phosphorylation of AMP-activated protein kinase (AMPK) and Akt in the ischemic heart.
24755035 Decreased serum omentin-1 levels are associated with poor cardiac outcome in patients with heart failure.
24659847 Serum and colonic omentin-1 expressions are decreased in active Crohn's disease patients.
24659266 omentin levels are elevated in patients with prostate cancer, independently of disease differentiation
24643693 Omentin might be an indicator of insulin resistance in pregnant women
24552613 results show that the rs2274907 polymorphism in the omentin gene is associated with daily energy intake as well as daily intake of fat and protein
24524360 Data suggest that adiposity is main determinant of down-regulation of omentin/ITLN1 and up-regulation of chemerin/RARRES2 levels in plasma of lean/overweight/obese women with polycystic ovary syndrome.
24397804 Morbidly obese and type 2 diabetes mellitus patients have decreased levels of serum omentin.
24392647 The adiponectin level was significantly lower in obese compared with normal weight subgroups, while the omentin-1 level was significantly lower in the PCOS compared with the non-PCOS group, and not related to body mass.
24370683 Although no significant difference was detected regarding omentin Val109Asp polymorphism, Val/Val genotype frequency was found to be more in patient group than control group. It may be speculated that Val/Val genotype increases the tendency for CAD.
24321036 This study was designed to evaluate the relationship between psoriasis and omentin serum levels and Val109Asp polymorphism in exon 4 of the omentin gene.
24085389 data indicates that serum omentin 1 levels are i) lower in obese children and ii) negatively correlated with BMI, WC, HOMA-IR and insulin levels suggesting that omentin 1 might be a biomarker for metabolic dysfunction also in childhood and adolescence.
24011638 The aim of the study was to evaluate the influence of vertical banded gastroplasty on peripheral blood concentrations of some adipocytokines and hormones involved in the control of food intake and energy turnover.
23959732 Data suggest that patients with newly diagnosed obstructive sleep apnoea syndrome exhibit higher omentin-1 plasma levels as compared to controls; after 3 months of continuous positive airway pressure therapy, plasma omentin-1 was decreased at 8 a.m.
23921499 The lactoferrin(LF) taken up, retained and subsequently released by the Intelectin 1(IntL)-transfectants was larger in amount than that of mock-transfectants.
23839538 Omentin is a recently identified novel adipocytokine and it falls under the category of being a good adipokine
23643964 Studies indicate that ITLN1 and ITLN2 intelectins are positioned on a single chromosome 1, suggesting mammalian intelectins have been independently expanded by partial gene duplication.
23605136 Decreased serum omentin-1 levels could be considered as an independent predictive marker of the presence and severity of obstructive sleep apnoea syndrome.
23555749 omentin-1 as a cardioprotective adipokine
23538212 The orexigenic effects of omentin-1 could be related, at least in part, to decreased CART and CRH gene expression.
23532633 Baseline serum omentin-1 levels can predict arterial stiffness changes occurring within a year. Further, changes in serum omentin-1 levels after a year can function as independent markers of arterial stiffening in patients with type 2 diabetes mellitus.
23490415 possible alterations in cord blood levels of insulin and the adipokines vaspin and omentin-1 were investigated in large-for-gestational age and appropriate-for-gestational age infants.
23474107 The observed higher levels of omentin-1, visfatin, and vaspin in patients with colorectal cancer (CRC), independent of measures of obesity, suggest that these adipocytokines may have a potential role in the development of CRC.
23303213 We make the novel observation of abnormal circulating and gluteal fat-secreted chemerin and omentin-1 levels in nascent metabolic syndrome, which could confer a higher risk for diabetes and cardiovascular disease.
23291856 plasma levels negatively correlate with the disease activity of psoriasis
23178529 the influence of omentin-1 on two types of human hepatocellular carcinoma cells
23144698 Data indicate that leptin, and omentin were positively correlated with osteoclast precursors (OCs) numbers.
23072466 Omentin-1 in synovial fluid might serve as a potential biomarker for reflecting the symptomatic severity of osteoarthritis.
22952622 pre-existing maternal obesity is associated with lower omentin-1 expression in placenta, adipose tissue and maternal plasma
22842465 These results suggest that omentin may inhibit TNF-alpha-induced expression of adhesion molecules in endothelial cells via blocking ERK/NF-kappaB pathway.
22813935 Omentin levels are elevated in patients receiving hemodialysis with end stage renal disease.
22801013 Intelectin-1 is expressed in human sinus mucosa and is increased in patients with nasal polyps.
22768319 Pleural intelectin-1 could be a useful diagnostic marker for MPM with applications in histopathological identification of MPM.
22721676 ITLN1 in combination with other known markers, such as CRP, could be evaluated as a panel of biomarkers of POAD.
22714099 Omentin-1/ITLN1 may exert a negative effect on bone mass by inhibiting bone formation in girls with anorexia nervosa.
22573572 In a Portuguese population, SNPs at three autophagy-related genes, ATG16L1, IRGM, and ITLN1, contribute to predict Crohn's ileal or ileocolonic disease, involvement of the upper digestive tract, and response to treatment.
22554771 Omentin plays an anti-inflammatory role by preventing the TNF-alpha-induced VCAM-1 expression in smooth muscle cells
22277902 the study demonstrates that variants of SLAMF1 and ITLN1, both implicated in inflammation, are associated with type 2 diabetes in Indians.
22222234 Synovial fluid omentin-1 levels decreased significantly as the Kellgren-Lawrence grades increased with radiographic severity of knee osteoarthritis.
22108456 Circulating omentin-1 level was independently correlated with arterial stiffness and carotid plaque in type 2 diabetes, even after adjusting for other cardiovascular risk factors and detailed medication history.
22083213 The aberrant ITLN-1 expression in gastric cancer is correlated with clinicopathological features and may be a useful prognostic factor for predicting the outcomes of gastric cancer patients.
22081609 omentin promotes endothelial cell function and revascularization in response to ischemia through its ability to stimulate an Akt-eNOS signaling pathway
22032341 Our study shows that omentin is significantly higher in juvenile idiopathic arthritis patients in comparison with healthy controls.
21935388 omentin-1 serum levels are correlated with BMD at the femoral neck and the serum levels of osteocalcin and osteopontin in MS patients
21925659 Low levels of omentin are closely linked with the presence of coronary artery disease and that omentin serves as a novel biomarker for CAD.
21865408 A significantly lower level of plasma omentin-1 is observed in non-obese women with polycystic ovary syndrome and normal glucose tolerance compared with body mass index- abd homeostasis model-matched controls.
21814208 circulating omentin levels independently and negatively associate with carotid intima-media thickness
21750093 Omentin-1 ameliorates arterial calcification and bone loss in vivo through the regulation of the RANK signalling pathway in osteoprotegerin-deficient mice.
21720428 Circulating omentin-1 in prepubertal children may be a early biological marker of insulin resistance, altered adipose-tissue metabolism, and hypertension, hypertriglyceridemia, type 2 diabetes, and/or obesity.
21602837 Serum omentin-1 levels were lower in patients with acute coronary syndrome (ACS) or stable angina pectoris (SAP) compared with controls (ACS, 113.08+/-61.43 ng/mL; SAP, 155.41+/-66.89 ng/mL; control, 254.00+/-72.9 ng/mL; P<0.01).
21514279 The present results demonstrate for the first time that omentin plays an anti-inflammatory role by preventing the TNF-alpha-induced COX-2 expression in vascular endothelial cells.
21497934 Omentin-1 is closely related to MetS and might play an important role in atherosclerosis in MetS patients.
21442174 Letter: serum omentin levels were significantly elevated in patients with Kawasaki disease.
21374544 there is such a close connection between serum omentin and adiponectin levels that regulation of omentin may be dependent on adiponectin.
21082206 Omentin inhibits osteoblast differentiation of calcifying vascular smooth muscle cells through the PI3K/Akt pathway.
21072187 Observational study of gene-disease association. (HuGE Navigator)
20852028 Increases in omentin-1(ITLN1) levels may play a role but are not sufficient to explain the decreased inflammatory and angiogenic effects of sera from metformin-treated PCOS women.
20823688 Even though the expression of NPY, omentin and visfatin was comparable between obese individuals and controls, we have to consider differences in the total production rate of adipose tissue-derived factors
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20488498 Higher omentin concentrations in the fetus may be crucial to enhance a growth-promoting effect
20473688 Observational study of gene-disease association. (HuGE Navigator)
20129687 Serum omentin-1 levels were decreased in impaired glucose regulation subjects. Lack of omentin-1 may contribute to the development of insulin resistance and type 2 diabetes.
20014019 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19760754 Observational study of gene-disease association. (HuGE Navigator)
19665576 miR-584 contributes to the post-transcriptional expression of lactoferrin receptor during the perinatal period.
19179460 intelectin is a host defense lectin that assists phagocytic clearance of microorganisms.
19000584 we have found evidence of a possible association between a single nucleotide polymorphism in intelectin-1 and asthma susceptibility that requires to be confirmed by independent studies
19000584 Observational study of gene-disease association. (HuGE Navigator)
18832735 intelectin 1 plays a role in defense against bacteria, its down-regulation in response to cigarette smoking is another example of the immunomodulatory effects of smoking on the immune system
18587394 Genome-wide association study of gene-disease association. (HuGE Navigator)
18174521 Omentin-1(ITLN1) is downregulated by insulin and glucose which may explain the decreased omentin-1 levels observed in our overweight women with polycystic ovary syndrome.
17329619 Decreased omentin levels are associated with increasing obesity and insulin resistance and may be predictive of problems associted with obesity.
17311679 Blood levels are not changed after a glucose tolerance test in normal adults.
17295929 Observational study of gene-disease association. (HuGE Navigator)
17295929 Val109Asp sequence variation is more a single nucleotide polymorphism than a real disease-causing mutation in type 2 diabetes or chronic inflammatory bowel disease.
16531507 Omentin increased Akt phosphorylation in the absence and presence of insulin. In conclusion, omentin is a new adipokine that is expressed in omental adipose tissue in humans and may regulate insulin action.
16386808 Omentin might be a new adipocytokine playing a role in the defense against intestinal bacterial translocation in the context of Crohn's disease.
16261254 Review focuses on current knowledge of the structure and function of mammalian lactoferrin receptors, mainly the first cloned Lf receptor that has been shown to be expressed in infant small intestine at high levels but also in virtually all other tissues.
15777968 Intelectin is consistently and highly overexpressed in a proportion of mesothelioma and gastrointestinal malignancies at the protein level

AA Sequence

MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFC      1 - 70
DMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYY     71 - 140
DIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVV    141 - 210
YDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQC    211 - 280
GDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR                                         281 - 313
//

Text Mined References (130)

PMID Year Title
26904686 2016 Assessment of Serum Concentrations of Ghrelin, Obestatin, Omentin-1, and Apelin in Children with Type 1 Diabetes.
26539805 2016 Circulating levels of adipocytokine omentin-1 in patients with renal cell cancer.
26514948 2015 The correlation of plasma omentin-1 with insulin resistance in non-obese polycystic ovary syndrome.
26466574 2015 Association of serum omentin levels with cardiac autonomic neuropathy in patients with type 2 diabetes mellitus: a hospital-based study.
26316585 2016 The impact of acute aerobic exercise on chitinase 3-like protein 1 and intelectin-1 expression in obesity.
26293449 2015 Serum omentin-1 levels as a possible risk factor of mortality in patients with diabetes on haemodialysis.
26291814 2015 Examination of angiopoietin-like protein 4, neuropeptide Y, omentin-1 levels of obese and non-obese patients with polycystic ovary syndrome.
26277181 2015 [Omentin - a newly-discovered adipocytokine in insulin resistance pathogenesis].
26148048 2015 Recognition of microbial glycans by human intelectin-1.
26144294 2015 Maternal serum omentin-1 profile is similar in humans and in the rat animal model.
26094489 2015 Low serum omentin levels in the elderly population with Type 2 diabetes and polyneuropathy.
26079253 2015 The protective functions of omentin in cardiovascular diseases.
25980946 2015 Omentin Polymorphism and its Relations to Bone Mineral Density in Women.
25965823 2015 Intelectin 1 suppresses tumor progression and is associated with improved survival in gastric cancer.
25904298 2015 Serum omentin, resistin and tumour necrosis factor-? levels in Behcet patients with and without ocular involvement.
25889839 2015 Intelectin 1 suppresses the growth, invasion and metastasis of neuroblastoma cells through up-regulation of N-myc downstream regulated gene 2.
25804090 2015 Serum omentin levels in adolescent girls with anorexia nervosa and obesity.
25789872 2015 Plasma omentin-1 levels are related to exercise performance in obese women and increase upon aerobic endurance training.
25733068 2015 Adiponectin may mediate the association between omentin, circulating lipids and insulin sensitivity: results from the KORA F4 study.
25690163 2015 Omentin-1 plasma levels and omentin-1 expression are decreased in psoriatic lesions of psoriasis patients.
25576244 2015 Decreased levels of serum omentin-1 in patients with inflammatory bowel disease.
25479337 2015 Omentin functions to attenuate cardiac hypertrophic response.
25453978 2014 Interactions between adiponectin, visfatin, and omentin in subcutaneous and visceral adipose tissues and serum, and correlations with clinical and peripheral metabolic factors.
25324439 2015 Omentin, an adipokine with insulin-sensitizing properties, is negatively associated with insulin resistance in normal gestation.
25300621 2015 Adipose-derived protein omentin prevents neointimal formation after arterial injury.
25294287 2014 A decreased serum omentin-1 level may be an independent risk factor for peripheral arterial disease.
25264991 2016 Serum Levels of Omentin in Pseudoexfoliation Syndrome.
25139582 2014 Omentin changes following bariatric surgery and predictive links with biomarkers for risk of cardiovascular disease.
25060690 2014 Circulating irisin, omentin-1, and lipoprotein subparticles in adults at higher cardiovascular risk.
24997770 2014 Changes of serum omentin-1 levels in normal subjects, type 2 diabetes and type 2 diabetes with overweight and obesity in Chinese adults.
24943040 2014 Expression and regulation of INTELECTIN1 in human granulosa-lutein cells: role in IGF-1-induced steroidogenesis through NAMPT.
24918534 2014 Serum omentin-1 levels in diabetic and nondiabetic patients with chronic kidney disease.
24912760 2015 Association of serum omentin-1 concentrations with the presence and severity of preeclampsia.
24852382 2014 Plasma omentin levels in drug-free patients with schizophrenia.
24768874 2014 Omentin prevents myocardial ischemic injury through AMP-activated protein kinase- and Akt-dependent mechanisms.
24755035 2014 Impact of serum omentin-1 levels on cardiac prognosis in patients with heart failure.
24659847 2014 Serum omentin-1 as a disease activity marker for Crohn's disease.
24659266 2014 Serum omentin level in patients with prostate cancer.
24643693 2014 Association between omentin levels and insulin resistance in pregnancy.
24552613 2015 The common polymorphism Val109Asp in the omentin gene is associated with daily energy intake in the Central-European population.
24524360 2014 Omentin and chemerin and their association with obesity in women with polycystic ovary syndrome.
24397804 2014 Serum concentrations and subcutaneous adipose tissue mRNA expression of omentin in morbid obesity and type 2 diabetes mellitus: the effect of very-low-calorie diet, physical activity and laparoscopic sleeve gastrectomy.
24392647 2014 Plasma omentin and adiponectin levels as markers of adipose tissue dysfunction in normal weight and obese women with polycystic ovary syndrome.
24370683 2014 Association of omentin Val109Asp polymorphism with coronary artery disease.
24321036 2014 Omentin serum levels and omentin gene Val109Asp polymorphism in patients with psoriasis.
24085389 2013 Low omentin-1 levels are related with clinical and metabolic parameters in obese children.
24011638 2013 Long-term impact of vertical banded gastroplasty (VBG) on plasma concentration of leptin, soluble leptin receptor, ghrelin, omentin-1, obestatin, and retinol binding protein 4 (RBP4) in patients with severe obesity.
23959732 2013 Melatonin and omentin: influence factors in the obstructive sleep apnoea syndrome?
23921499 2013 A lactoferrin-receptor, intelectin 1, affects uptake, sub-cellular localization and release of immunochemically detectable lactoferrin by intestinal epithelial Caco-2 cells.
23839538 2013 Emergence of omentin as a pleiotropic adipocytokine.
23643964 2013 Comparative genomic and phylogenetic analyses of the intelectin gene family: implications for their origin and evolution.
23605136 2013 Decreased levels of serum omentin-1 in patients with obstructive sleep apnoea syndrome.
23555749 2013 Cardioprotective properties of omentin-1 in type 2 diabetes: evidence from clinical and in vitro studies.
23538212 2013 Orexigenic effects of omentin-1 related to decreased CART and CRH gene expression and increased norepinephrine synthesis and release in the hypothalamus.
23532633 2013 Implication of circulating omentin-1 level on the arterial stiffening in type 2 diabetes mellitus.
23490415 2013 Adipokines vaspin and omentin-1 are up-regulated in large for gestational age infants at term.
23474107 2013 Circulating levels of novel adipocytokines in patients with colorectal cancer.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23303213 2013 Increased chemerin and decreased omentin-1 in both adipose tissue and plasma in nascent metabolic syndrome.
23291856 2013 Increased plasma resistin and decreased omentin levels in Japanese patients with psoriasis.
23178529 2013 Omentin-1, a new adipokine, promotes apoptosis through regulating Sirt1-dependent p53 deacetylation in hepatocellular carcinoma cells.
23144698 2012 Adipokines in psoriatic arthritis patients: the correlations with osteoclast precursors and bone erosions.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23072466 2012 Decreased synovial fluid omentin-1 concentrations reflect symptomatic severity in patients with knee osteoarthritis.
22952622 2012 Omentin-1 is decreased in maternal plasma, placenta and adipose tissue of women with pre-existing obesity.
22842465 2012 Omentin inhibits TNF-?-induced expression of adhesion molecules in endothelial cells via ERK/NF-?B pathway.
22813935 2012 Serum levels of omentin in end-stage renal disease patients.
22801013 Increased expression of intelectin-1 in nasal polyps.
22768319 2012 Specific expression of human intelectin-1 in malignant pleural mesothelioma and gastrointestinal goblet cells.
22721676 Assessment of gene expression profiles in peripheral occlusive arterial disease.
22714099 2013 Relationship between serum omentin-1 level and bone mineral density in girls with anorexia nervosa.
22573572 2013 Phenotype-genotype profiles in Crohn's disease predicted by genetic markers in autophagy-related genes (GOIA study II).
22554771 2012 Omentin plays an anti-inflammatory role through inhibition of TNF-?-induced superoxide production in vascular smooth muscle cells.
22277902 2012 Common variants of SLAMF1 and ITLN1 on 1q21 are associated with type 2 diabetes in Indian population.
22222234 2012 Synovial fluid omentin-1 levels are inversely correlated with radiographic severity of knee osteoarthritis.
22108456 2011 Association of circulating omentin-1 level with arterial stiffness and carotid plaque in type 2 diabetes.
22083213 2012 Aberrant expression of intelectin-1 in gastric cancer: its relationship with clinicopathological features and prognosis.
22081609 2012 Fat-derived factor omentin stimulates endothelial cell function and ischemia-induced revascularization via endothelial nitric oxide synthase-dependent mechanism.
22032341 Circulating levels of the adipokines vaspin and omentin in patients with juvenile idiopathic arthritis, and relation to disease activity.
21935388 2011 Correlation of circulating omentin-1 with bone mineral density in multiple sclerosis: the crosstalk between bone and adipose tissue.
21925659 2011 Circulating omentin is associated with coronary artery disease in men.
21865408 2011 Plasma omentin-1 levels are reduced in non-obese women with normal glucose tolerance and polycystic ovary syndrome.
21814208 2011 Association of a fat-derived plasma protein omentin with carotid artery intima-media thickness in apparently healthy men.
21750093 2011 Omentin-1 attenuates arterial calcification and bone loss in osteoprotegerin-deficient mice by inhibition of RANKL expression.
21720428 2011 Toward an early marker of metabolic dysfunction: omentin-1 in prepubertal children.
21602837 2011 Association of serum omentin-1 levels with coronary artery disease.
21514279 2011 Omentin, a novel adipocytokine inhibits TNF-induced vascular inflammation in human endothelial cells.
21497934 2011 Omentin-1 is associated with carotid atherosclerosis in patients with metabolic syndrome.
21442174 2012 Circulating levels of the adipocytokines vaspin and omentin in patients with Kawasaki disease.
21374544 2011 Changes of serum omentin levels and relationship between omentin and adiponectin concentrations in type 2 diabetes mellitus.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21082206 2011 Omentin inhibits osteoblastic differentiation of calcifying vascular smooth muscle cells through the PI3K/Akt pathway.
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
20852028 2010 Metformin treatment may increase omentin-1 levels in women with polycystic ovary syndrome.
20823688 2010 Expression of neuropeptide Y, omentin and visfatin in visceral and subcutaneous adipose tissues in humans: relation to endocrine and clinical parameters.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20488498 2011 Omentin-1 and vaspin are present in the fetus and neonate, and perinatal concentrations are similar in normal and growth-restricted pregnancies.
20473688 2010 Association between genome-wide association studies reported SNPs and pediatric-onset Crohn's disease in Canadian children.
20129687 2010 Changes of serum omentin-1 levels in normal subjects and in patients with impaired glucose regulation and with newly diagnosed and untreated type 2 diabetes.
20014019 2010 Genome wide association (GWA) predictors of anti-TNFalpha therapeutic responsiveness in pediatric inflammatory bowel disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19665576 2010 miR-584 mediates post-transcriptional expression of lactoferrin receptor in Caco-2 cells and in mouse small intestine during the perinatal period.
19179460 2009 Capture of heat-killed Mycobacterium bovis bacillus Calmette-Guérin by intelectin-1 deposited on cell surfaces.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19000584 2008 A single-nucleotide polymorphism in intelectin 1 is associated with increased asthma risk.
18832735 2008 Decreased expression of intelectin 1 in the human airway epithelium of smokers compared to nonsmokers.
18587394 2008 Genome-wide association defines more than 30 distinct susceptibility loci for Crohn's disease.
18174521 2008 Omentin-1, a novel adipokine, is decreased in overweight insulin-resistant women with polycystic ovary syndrome: ex vivo and in vivo regulation of omentin-1 by insulin and glucose.
17621593 2007 Differential structure and activity between human and mouse intelectin-1: human intelectin-1 is a disulfide-linked trimer, whereas mouse homologue is a monomer.
17329619 2007 Omentin plasma levels and gene expression are decreased in obesity.
17311679 2007 Plasma levels of leptin, omentin, collagenous repeat-containing sequence of 26-kDa protein (CORS-26) and adiponectin before and after oral glucose uptake in slim adults.
17295929 2007 Frequency and significance of the novel single nucleotide missense polymorphism Val109Asp in the human gene encoding omentin in Caucasian patients with type 2 diabetes mellitus or chronic inflammatory bowel diseases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16531507 2006 Identification of omentin as a novel depot-specific adipokine in human adipose tissue: possible role in modulating insulin action.
16386808 2005 Genomic structure of human omentin, a new adipocytokine expressed in omental adipose tissue.
16261254 2005 Mammalian lactoferrin receptors: structure and function.
15777968 2005 Identification of intelectin overexpression in malignant pleural mesothelioma by serial analysis of gene expression (SAGE).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14720597 2004 The Xenopus laevis cortical granule lectin: cDNA cloning, developmental expression, and identification of the eglectin family of lectins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11747454 2001 Molecular cloning and functional expression of a human intestinal lactoferrin receptor.
11313366 2001 Human intelectin is a novel soluble lectin that recognizes galactofuranose in carbohydrate chains of bacterial cell wall.
11181563 2001 Human homologs of the Xenopus oocyte cortical granule lectin XL35.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.