Property Summary

NCBI Gene PubMed Count 41
PubMed Score 2148.71
PubTator Score 2562.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.948 4.8e-06
pancreatic ductal adenocarcinoma liver m... -2.371 4.4e-03

Gene RIF (16)

PMID Text
26408095 ITIH4 peptide isoform as a preterm birth biomarker and its associated SNP implications
26206863 confirmed the association of schizophrenia with ITIH3/4 in a Han Chinese population
25977605 Serum ITIH4 may be a PM10-specific biomarker in COPD and may be related to inflammation.
24884609 Isoform-specific ITIH4 glycosylation and utilization of O-glycosylation sites on ITIH4 differs between cell lines and serum.
24861553 Four novel body mass index-associated loci near the KCNQ1(rs2237892), ALDH2/MYL2 (rs671, rs12229654), ITIH4 (rs2535633) and NT5C2 (rs11191580) genes are identified in East Asian-ancestry populations.
24836184 Worse survival among HCC patients with low ITIH4.
24461634 A novel association between suicide attempt and the ITIH3/4-region in a combined group of patients with bipolar disorder, schizophrenia and related psychosis spectrum disorders.
23436019 Expression of the 85 kDa ITIH4 was substantial in amyotrophic lateral sclerosis compared with controls or patients with muscular dystrophy, Alzheimer diseases, or Parkinson diseases
23417432 A truncated fragment of inter-alpha-trypsin inhibitor heavy chain 4 was the sole protein found to be significantly enhanced in the prostate cancer patients compared to the controls.
21331437 Findings suggest that ITI-H4 expression may be used as a biomarker, which could facilitate the development of novel diagnostic and therapeutic tools.
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19263524 ITIH4 is an anti-inflammatory protein, and suggests that further investigation into its potential use in the diagnosis and prognosis of acute ischemic stroke is warranted.
18455532 The inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4) protein was significantly present more in interstial cystitis than controls
16271702 ITIH4 and MTJ1 co-immunoprecipitate from total liver protein extracts and SANT domain of HTJ1 protects the ITIH4(588-930) recombinant fragment
14661079 Observational study of gene-disease association. (HuGE Navigator)
14661079 Genetic variation at ITIH4 locus is one of the likely candidate determinants for plasma cholesterol metabolisms

AA Sequence

MKPPRPVRTCSKVLVLLSLLAIHQTTTAEKNGIDIYSLTVDSRVSSRFAHTVVTSRVVNRANTVQEATFQ      1 - 70
MELPKKAFITNFSMIIDGMTYPGIIKEKAEAQAQYSAAVAKGKSAGLVKATGRNMEQFQVSVSVAPNAKI     71 - 140
TFELVYEELLKRRLGVYELLLKVRPQQLVKHLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQNKTK    141 - 210
AHIRFKPTLSQQQKSPEQQETVLDGNLIIRYDVDRAISGGSIQIENGYFVHYFAPEGLTTMPKNVVFVID    211 - 280
KSGSMSGRKIQQTREALIKILDDLSPRDQFNLIVFSTEATQWRPSLVPASAENVNKARSFAAGIQALGGT    281 - 350
NINDAMLMAVQLLDSSNQEERLPEGSVSLIILLTDGDPTVGETNPRSIQNNVREAVSGRYSLFCLGFGFD    351 - 420
VSYAFLEKLALDNGGLARRIHEDSDSALQLQDFYQEVANPLLTAVTFEYPSNAVEEVTQNNFRLLFKGSE    421 - 490
MVVAGKLQDRGPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPKYIFHNFMERLWAYLTIQQLLEQT    491 - 560
VSASDADQQALRNQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESRNRNVHSGSTFFKYYLQ    561 - 630
GAKIPKPEASFSPRRGWNRQAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASAPPA    631 - 700
TSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVT    701 - 770
GQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDP    771 - 840
DKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRER    841 - 910
RLDYQEGPPGVEISCWSVEL                                                      911 - 930
//

Text Mined References (49)

PMID Year Title
26408095 2015 Serological targeted analysis of an ITIH4 peptide isoform: a preterm birth biomarker and its associated SNP implications.
26206863 2015 Loci with genome-wide associations with schizophrenia in the Han Chinese population.
25977605 2015 Inter-alpha-trypsin inhibitor heavy chain 4: a novel biomarker for environmental exposure to particulate air pollution in patients with chronic obstructive pulmonary disease.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24884609 2014 Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24836184 2014 Inter-alpha-trypsin inhibitor heavy chain H4 as a diagnostic and prognostic indicator in patients with hepatitis B virus-associated hepatocellular carcinoma.
24461634 2014 Association analysis between suicidal behaviour and candidate genes of bipolar disorder and schizophrenia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23436019 2013 ITIH4 and Gpx3 are potential biomarkers for amyotrophic lateral sclerosis.
23417432 2013 Urine of patients with early prostate cancer contains lower levels of light chain fragments of inter-alpha-trypsin inhibitor and saposin B but increased expression of an inter-alpha-trypsin inhibitor heavy chain 4 fragment.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21331437 2011 ITI-H4, as a biomarker in the serum of recurrent pregnancy loss (RPL) patients.
21269460 2011 Initial characterization of the human central proteome.
21137033 2010 The absolute quantification of eight inter-?-trypsin inhibitor heavy chain 4 (ITIH4)-derived peptides in serum from breast cancer patients.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19263524 2009 Inter-alpha-trypsin inhibitor heavy chain 4 is a novel marker of acute ischemic stroke.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18455532 2008 Proteomic techniques identify urine proteins that differentiate patients with interstitial cystitis from asymptomatic control subjects.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16271702 2005 BIP co-chaperone MTJ1/ERDJ1 interacts with inter-alpha-trypsin inhibitor heavy chain 4.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14661079 2004 Hypercholesterolemia associated with splice-junction variation of inter-alpha-trypsin inhibitor heavy chain 4 (ITIH4) gene.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12147176 2002 SNP analysis of the inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP) gene by a fluorescence-adapted SSCP method.
10486281 1999 ITIH4 serum concentration increases during acute-phase processes in human patients and is up-regulated by interleukin-6 in hepatocarcinoma HepG2 cells.
9756925 1998 Human inter-alpha-trypsin inhibitor heavy chain H3 gene. Genomic organization, promoter analysis, and gene linkage.
9480842 1998 The H4P heavy chain of inter-alpha-inhibitor family largely differs in the structure and synthesis of its prolin-rich region from rat to human.
9126497 1997 Comparative assignments of the genes of the inter-alpha-inhibitor family in human and mouse: ITIH4 is close to ITIH1 and ITIH3, on HSA 3 and MMU 14.
8797089 1996 Isolation and characterization of the human inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP) gene (ITIHL1).
7947966 1994 Purification and characterization of a novel substrate for plasma kallikrein (PK-120) in human plasma.
7805892 1995 cDNA and deduced amino acid sequence of human PK-120, a plasma kallikrein-sensitive glycoprotein.
7775381 1995 Cloning and characterization of cDNA for inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP), a novel human plasma glycoprotein.
7587397 1995 Mapping of human inter-alpha-trypsin inhibitor family heavy chain-related protein gene (ITIHL1) to human chromosome 3p21-->p14.
7541790 1995 Purification and characterization of a novel glycoprotein which has significant homology to heavy chains of inter-alpha-trypsin inhibitor family from human plasma.