Property Summary

NCBI Gene PubMed Count 36
PubMed Score 16.73
PubTator Score 10.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.038 2.0e-02
lung cancer -1.300 4.6e-02
sonic hedgehog group medulloblastoma 2.400 2.1e-03
ovarian cancer 1.300 1.3e-08

Gene RIF (8)

PMID Text
26728454 Data suggest that Mg2+ or Mn2+ (but not Ca2+) induce a conformational change in inter-alpha-inhibitor (ITIH1 and ITIH2) and a bikunin/chondroitin sulfate-dependent increase in thermodynamic stability; bikunin binds adjacent to the two heavy chains.
21939789 Human inter-alpha-inhibitor is a substrate for factor XIIIa and tissue transglutaminase.
20297716 It forms complex with hyaluronan and the comlex is a functional molecule involved in inflammation.
18425383 serum-derived hyaluronan-associated protein-hyaluronan complex has a role in progression of ovarian cancer
18382897 Increased levels of SHAP-HA complex in sera are possible predictive markers for cervical ripening in premature labor.
16702221 Leukocytes infiltrated to the synovium were strongly positive for hyaluronic acid, SHAP, and CD44 on their surfaces, suggesting a role for the adhesion-enhancing effect of SHAP in inflammation.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15840581 TSG-6 acts as cofactor and catalyst in the production of IalphaI heavy chain x hyaluronan complexes

AA Sequence

MKRLTCFFICFFLSEVSGFEIPINGLSEFVDYEDLVELAPGKFQLVAENRRYQRSLPGESEEMMEEVDQV      1 - 70
TLYSYKVQSTITSRMATTMIQSKVVNNSPQPQNVVFDVQIPKGAFISNFSMTVDGKTFRSSIKEKTVGRA     71 - 140
LYAQARAKGKTAGLVRSSALDMENFRTEVNVLPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLE    141 - 210
VDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRETAVDGELVVLYDVK    211 - 280
REEKAGELEVFNGYFVHFFAPDNLDPIPKNILFVIDVSGSMWGVKMKQTVEAMKTILDDLRAEDHFSVID    281 - 350
FNQNIRTWRNDLISATKTQVADAKRYIEKIQPSGGTNINEALLRAIFILNEANNLGLLDPNSVSLIILVS    351 - 420
DGDPTVGELKLSKIQKNVKENIQDNISLFSLGMGFDVDYDFLKRLSNENHGIAQRIYGNQDTSSQLKKFY    421 - 490
NQVSTPLLRNVQFNYPHTSVTDVTQNNFHNYFGGSEIVVAGKFDPAKLDQIESVITATSANTQLVLETLA    491 - 560
QMDDLQDFLSKDKHADPDFTRKLWAYLTINQLLAERSLAPTAAAKRRITRSILQMSLDHHIVTPLTSLVI    561 - 630
ENEAGDERMLADAPPQDPSCCSGALYYGSKVVPDSTPSWANPSPTPVISMLAQGSQVLESTPPPHVMRVE    631 - 700
NDPHFIIYLPKSQKNICFNIDSEPGKILNLVSDPESGIVVNGQLVGAKKPNNGKLSTYFGKLGFYFQSED    701 - 770
IKIEISTETITLSHGSSTFSLSWSDTAQVTNQRVQISVKKEKVVTITLDKEMSFSVLLHRVWKKHPVNVD    771 - 840
FLGIYIPPTNKFSPKAHGLIGQFMQEPKIHIFNERPGKDPEKPEASMEVKGQKLIITRGLQKDYRTDLVF    841 - 910
GTDVTCWFVHNSGKGFIDGHYKDYFVPQLYSFLKRP                                      911 - 946
//

Text Mined References (42)

PMID Year Title
26728454 2016 The Compact and Biologically Relevant Structure of Inter-?-inhibitor Is Maintained by the Chondroitin Sulfate Chain and Divalent Cations.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22116950 2012 Genetic variants and environmental factors associated with hormonal markers of ovarian reserve in Caucasian and African American women.
21939789 2011 Human inter-?-inhibitor is a substrate for factor XIIIa and tissue transglutaminase.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20297716 2010 [Covalent complex of hyaluronan and serum-derived protein, SHAP is a functional molecule involved in inflammation: finding, structure, formation mechanism, and function of the complex].
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18425383 2008 Role of serum-derived hyaluronan-associated protein-hyaluronan complex in ovarian cancer.
18382897 2008 Hyaluronan (HA) and serum-derived hyaluronan-associated protein (SHAP)-HA complex as predictive markers of cervical ripening in premature labor.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16702221 2006 SHAP potentiates the CD44-mediated leukocyte adhesion to the hyaluronan substratum.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15840581 2005 Characterization of complexes formed between TSG-6 and inter-alpha-inhibitor that act as intermediates in the covalent transfer of heavy chains onto hyaluronan.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14744536 2004 ITIH5, a novel member of the inter-alpha-trypsin inhibitor heavy chain family is downregulated in breast cancer.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10100603 1999 The nuclear protein PH5P of the inter-alpha-inhibitor superfamily: a missing link between poly(ADP-ribose)polymerase and the inter-alpha-inhibitor family and a novel actor of DNA repair?
9677337 1998 Glycosylation pattern of human inter-alpha-inhibitor heavy chains.
9514613 1998 Gene expression of the two heavy chains and one light chain forming the inter-alpha-trypsin-inhibitor in human tissues.
9425062 1998 Posttranslational modifications of human inter-alpha-inhibitor: identification of glycans and disulfide bridges in heavy chains 1 and 2.
8601712 1996 Development of an enzyme-linked immunosorbent assay for human plasma inter-alpha-trypsin inhibitor (ITI) using specific antibodies against each of the H1 and H2 heavy chains.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7682553 1993 Presence of the protein-glycosaminoglycan-protein covalent cross-link in the inter-alpha-inhibitor-related proteinase inhibitor heavy chain 2/bikunin.
7516184 1994 TSG-6, an arthritis-associated hyaluronan binding protein, forms a stable complex with the serum protein inter-alpha-inhibitor.
7513643 1994 Chondroitin sulphate covalently cross-links the three polypeptide chains of inter-alpha-trypsin inhibitor.
7504674 1993 A serum-derived hyaluronan-associated protein (SHAP) is the heavy chain of the inter alpha-trypsin inhibitor.
3663330 1987 cDNA cloning of human inter-alpha-trypsin inhibitor discloses three different proteins.
2476436 1989 Analysis of inter-alpha-trypsin inhibitor and a novel trypsin inhibitor, pre-alpha-trypsin inhibitor, from human plasma. Polypeptide chain stoichiometry and assembly by glycan.
2465147 1989 Human plasma inter-alpha-trypsin inhibitor is encoded by four genes on three chromosomes.
2462430 1988 Human inter-alpha-trypsin inhibitor. Isolation and characterization of heavy (H) chain cDNA clones coding for a 383 amino-acid sequence of the H chain.
2450046 1988 Complementary DNA and derived amino acid sequence of the precursor of one of the three protein components of the inter-alpha-trypsin inhibitor complex.
2446322 1987 Isolation and characterization of cDNAs encoding the heavy chain of human inter-alpha-trypsin inhibitor (I alpha TI): unambiguous evidence for multipolypeptide chain structure of I alpha TI.
1385302 1992 Homologous chromosomal locations of the four genes for inter-alpha-inhibitor and pre-alpha-inhibitor family in human and mouse: assignment of the ancestral gene for the lipocalin superfamily.
1384548 1992 The heavy chains of human plasma inter-alpha-trypsin inhibitor: their isolation, their identification by electrophoresis and partial sequencing. Differential reactivity with concanavalin A.