Property Summary

NCBI Gene PubMed Count 43
PubMed Score 23.23
PubTator Score 29.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Liver neoplasms 108
Disease Target Count P-value
psoriasis 6685 1.6e-20
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Bipolar Disorder 266 0.0 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 1.6e-20

Gene RIF (9)

PMID Text
26728454 Data suggest that Mg2+ or Mn2+ (but not Ca2+) induce a conformational change in inter-alpha-inhibitor (ITIH1 and ITIH2) and a bikunin/chondroitin sulfate-dependent increase in thermodynamic stability; bikunin binds adjacent to the two heavy chains.
24389398 The results of this study revealed that the shared genetic risk factors of both schizophrenia and major depressive disorder exist in ITIH family genes in the Han Chinese population.
24005673 Data indicate that TSG-6-mediated cross-linking of hyaluronan (HA) films is impaired in the presence of inter-alpha-inhibitor (IalphaI) and that this effect suppresses the TSG-6-mediated enhancement of HA binding to CD44-positive cells.
21939789 Human inter-alpha-inhibitor is a substrate for factor XIIIa and tissue transglutaminase.
19416921 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18226209 The first systematic analysis on the differential expression of ITIH genes in human cancer, showing frequent downregulation that may be associated with initiation and/or progression of these malignancies.
17675295 PTX3 directly interacts with inter-alpha-trypsin inhibitor and has a role in hyaluronan organization and cumulus oophorus expansion
11807786 Transfection into H460M Human large cell lung carcinoma line decreased tumor metastasis in nude mice

AA Sequence

MDGAMGPRGLLLCMYLVSLLILQAMPALGSATGRSKSSEKRQAVDTAVDGVFIRSLKVNCKVTSRFAHYV      1 - 70
VTSQVVNTANEAREVAFDLEIPKTAFISDFAVTADGNAFIGDIKDKVTAWKQYRKAAISGENAGLVRASG     71 - 140
RTMEQFTIHLTVNPQSKVTFQLTYEEVLKRNHMQYEIVIKVKPKQLVHHFEIDVDIFEPQGISKLDAQAS    141 - 210
FLPKELAAQTIKKSFSGKKGHVLFRPTVSQQQSCPTCSTSLLNGHFKVTYDVSRDKICDLLVANNHFAHF    211 - 280
FAPQNLTNMNKNVVFVIDISGSMRGQKVKQTKEALLKILGDMQPGDYFDLVLFGTRVQSWKGSLVQASEA    281 - 350
NLQAAQDFVRGFSLDEATNLNGGLLRGIEILNQVQESLPELSNHASILIMLTDGDPTEGVTDRSQILKNV    351 - 420
RNAIRGRFPLYNLGFGHNVDFNFLEVMSMENNGRAQRIYEDHDATQQLQGFYSQVAKPLLVDVDLQYPQD    421 - 490
AVLALTQNHHKQYYEGSEIVVAGRIADNKQSSFKADVQAHGEGQEFSITCLVDEEEMKKLLRERGHMLEN    491 - 560
HVERLWAYLTIQELLAKRMKVDREERANLSSQALQMSLDYGFVTPLTSMSIRGMADQDGLKPTIDKPSED    561 - 630
SPPLEMLGPRRTFVLSALQPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQKEDTLCFNINEEPGVILSL    631 - 700
VQDPNTGFSVNGQLIGNKARSPGQHDGTYFGRLGIANPATDFQLEVTPQNITLNPGFGGPVFSWRDQAVL    701 - 770
RQDGVVVTINKKRNLVVSVDDGGTFEVVLHRVWKGSSVHQDFLGFYVLDSHRMSARTHGLLGQFFHPIGF    771 - 840
EVSDIHPGSDPTKPDATMVVRNRRLTVTRGLQKDYSKDPWHGAEVSCWFIHNNGAGLIDGAYTDYIVPDI    841 - 910
F//

Text Mined References (49)

PMID Year Title
26728454 2016 The Compact and Biologically Relevant Structure of Inter-?-inhibitor Is Maintained by the Chondroitin Sulfate Chain and Divalent Cations.
25173105 2014 Common variants near ABCA1, AFAP1 and GMDS confer risk of primary open-angle glaucoma.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24389398 2014 ITIH family genes confer risk to schizophrenia and major depressive disorder in the Han Chinese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24166486 2013 GWAS meta analysis identifies TSNARE1 as a novel Schizophrenia / Bipolar susceptibility locus.
24005673 2013 Inter-?-inhibitor impairs TSG-6-induced hyaluronan cross-linking.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21939789 2011 Human inter-?-inhibitor is a substrate for factor XIIIa and tissue transglutaminase.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
19416921 2009 Genome-wide association and meta-analysis of bipolar disorder in individuals of European ancestry.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18226209 2008 Frequent expression loss of Inter-alpha-trypsin inhibitor heavy chain (ITIH) genes in multiple human solid tumors: a systematic expression analysis.
17675295 2007 PTX3 interacts with inter-alpha-trypsin inhibitor: implications for hyaluronan organization and cumulus oophorus expansion.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11807786 2002 Inhibition of tumor growth and metastatic spreading by overexpression of inter-alpha-trypsin inhibitor family chains.
10100603 1999 The nuclear protein PH5P of the inter-alpha-inhibitor superfamily: a missing link between poly(ADP-ribose)polymerase and the inter-alpha-inhibitor family and a novel actor of DNA repair?
9756925 1998 Human inter-alpha-trypsin inhibitor heavy chain H3 gene. Genomic organization, promoter analysis, and gene linkage.
9692908 1998 Disulphide bonds assignment in the inter-alpha-inhibitor heavy chains--structural and functional implications.
9677337 1998 Glycosylation pattern of human inter-alpha-inhibitor heavy chains.
9425062 1998 Posttranslational modifications of human inter-alpha-inhibitor: identification of glycans and disulfide bridges in heavy chains 1 and 2.
7681778 1993 Human pre-alpha-trypsin inhibitor-precursor heavy chain. cDNA and deduced amino-acid sequence.
7592891 1995 Evidence for the covalent binding of SHAP, heavy chains of inter-alpha-trypsin inhibitor, to hyaluronan.
7535743 1995 Molecular basis of inter-alpha-trypsin inhibitor heavy chain H1 (ITIH1) polymorphism.
7522574 1994 Tandem orientation of the inter-alpha-trypsin inhibitor heavy chain H1 and H3 genes.
7513643 1994 Chondroitin sulphate covalently cross-links the three polypeptide chains of inter-alpha-trypsin inhibitor.
7505744 1993 Isolation and characterization of the human inter-alpha-trypsin inhibitor heavy-chain H1 gene.
7504674 1993 A serum-derived hyaluronan-associated protein (SHAP) is the heavy chain of the inter alpha-trypsin inhibitor.
3663330 1987 cDNA cloning of human inter-alpha-trypsin inhibitor discloses three different proteins.
2476436 1989 Analysis of inter-alpha-trypsin inhibitor and a novel trypsin inhibitor, pre-alpha-trypsin inhibitor, from human plasma. Polypeptide chain stoichiometry and assembly by glycan.
2471637 1989 Two out of the three kinds of subunits of inter-alpha-trypsin inhibitor are structurally related.
2465147 1989 Human plasma inter-alpha-trypsin inhibitor is encoded by four genes on three chromosomes.
2446322 1987 Isolation and characterization of cDNAs encoding the heavy chain of human inter-alpha-trypsin inhibitor (I alpha TI): unambiguous evidence for multipolypeptide chain structure of I alpha TI.
1385302 1992 Homologous chromosomal locations of the four genes for inter-alpha-inhibitor and pre-alpha-inhibitor family in human and mouse: assignment of the ancestral gene for the lipocalin superfamily.
1384548 1992 The heavy chains of human plasma inter-alpha-trypsin inhibitor: their isolation, their identification by electrophoresis and partial sequencing. Differential reactivity with concanavalin A.
1380832 1992 Human inter-alpha-trypsin inhibitor: full-length cDNA sequence of the heavy chain H1.