Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.05
PubTator Score 6.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma -1.200 2.1e-03
psoriasis -1.700 8.5e-03
cutaneous lupus erythematosus -1.100 5.0e-02
osteosarcoma -3.133 3.4e-03
posterior fossa group A ependymoma 2.300 1.5e-08
cystic fibrosis 1.600 1.3e-02
glioblastoma 1.400 4.9e-02
sonic hedgehog group medulloblastoma 1.600 2.3e-02
Atopic dermatitis -1.900 1.3e-05
primary pancreatic ductal adenocarcinoma 2.598 1.5e-04
non-small cell lung cancer -1.163 3.6e-05
intraductal papillary-mucinous adenoma (... -2.900 7.7e-03
intraductal papillary-mucinous carcinoma... -3.400 5.3e-03
intraductal papillary-mucinous neoplasm ... -3.300 2.7e-02
lung cancer -1.400 2.7e-02
pancreatic cancer 2.700 4.3e-03
interstitial cystitis -1.100 2.0e-02
adult high grade glioma 1.100 9.9e-03
invasive ductal carcinoma 2.885 8.7e-05
lung adenocarcinoma 1.311 9.5e-03
Breast cancer -2.800 7.6e-17
gastric carcinoma 2.400 4.5e-02
ovarian cancer 2.300 2.8e-02
pituitary cancer -2.500 1.3e-04
head and neck cancer -2.000 2.5e-03

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (4)

PMID Text
26060017 Data indicate the transforming growth factor beta (TGFbeta) signaling pathway as a downstream effector of integrin beta-like 1 (ITGBL1) and the transcription factor Runx2 as an upstream activator of ITGBL1 expression.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCD      1 - 70
CGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSN     71 - 140
QMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAG    141 - 210
WHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVY    211 - 280
DRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYP    281 - 350
PGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADG    351 - 420
ILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLG    421 - 490
SEYP                                                                      491 - 494
//

Text Mined References (18)

PMID Year Title
26060017 2015 ITGBL1 Is a Runx2 Transcriptional Target and Promotes Breast Cancer Bone Metastasis by Activating the TGF? Signaling Pathway.
24132900 2013 Genome-wide association study of atypical psychosis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23145134 2012 Mid-gestational gene expression profile in placenta and link to pregnancy complications.
21284329 2010 Identification of two novel chromosome regions associated with isolated growth hormone deficiency.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12364586 2002 Genetic and physiological data implicating the new human gene G72 and the gene for D-amino acid oxidase in schizophrenia.
11572973 2001 Definition of EGF-like, closely interacting modules that bear activation epitopes in integrin beta subunits.
10051402 1999 Cloning and characterization of a novel beta integrin-related cDNA coding for the protein TIED ("ten beta integrin EGF-like repeat domains") that maps to chromosome band 13q33: A divergent stand-alone integrin stalk structure.