1. Home
  2. Targets
  3. cell adhesion molecule
  4. extracellular matrix glycoprotein
  5. Integrin beta-5

Tbio Integrin beta-5

(Microbial infection) Integrin ITGAV:ITGB5 acts as a receptor for adenovirus type C.

 Comments

Property Summary

NCBI Gene PubMed Count 111
PubMed Score 27.11
PubTator Score 40.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Juvenile arthritis 124
Thyroid Diseases 12

Expression

  Differential Expression (17)

Disease log2 FC p
pancreatic cancer 1.600 8.1e-04
psoriasis -1.600 4.3e-04
cutaneous lupus erythematosus -1.200 4.0e-03
osteosarcoma -2.126 1.1e-03
astrocytoma 2.100 2.8e-03
glioblastoma 1.300 1.1e-02
medulloblastoma, large-cell -1.400 9.8e-05
Atopic dermatitis -1.100 2.0e-04
primary pancreatic ductal adenocarcinoma 1.586 7.3e-04
diabetes mellitus -1.100 2.8e-03
group 3 medulloblastoma -1.400 1.5e-02
posterior fossa group B ependymoma 1.100 5.7e-06
pancreatic carcinoma 1.100 9.4e-04
lung carcinoma -1.100 7.4e-07
mucosa-associated lymphoid tissue lympho... 2.211 1.5e-02
invasive ductal carcinoma -1.200 2.0e-02
ovarian cancer 2.200 4.7e-04

Synonym

Accession P18084 B0LPF8 B2RD70
Symbols

Gene

ITGB5

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (16)

See all...

 GO Function (1)

 GO Component (7)

 GO Process (9)

 Compartment GO Term (49)

See all...

 IMPC Phenotype (4)

 MGI Phenotype (8)

 HCA RNA Cell Line (56)

See all...

 CSPA Cell Line (20)

See all...

Pathway (37)

See all...

Protein-protein Interaction (27)

MYL12A   SORBS3   TGFB1   VTN   TPM3   TPM2   TPM1   SPP1   TGFB3   MYL6B   VCL   SDC1   MYL12A   MYL9   LMOD1   MYH11   PXN   MYL6   TPM4   MYL7   MYL5   CALD1   MYLK   MYLPF   MYL10   SORBS1   TLN1  

Gene RIF (70)

PMID Text
26244551 Data suggest that the binding, but not the internalization of photoreceptor outer segments (POS) confers protective effects on retinal pigment epithelium (RPE) cells through the alphavbeta5 integrin/focal adhesion kinase (FAK)/PGC-1alpha pathway.
25472585 ITGA3, ITGA6, ITGB3,ITGB4 and ITGB5 are associated with GC susceptibility (rs2675), ITGA3, ITGA6, ITGB3, ITGB4 and ITGB5 are associated with gastric cancer susceptibility tumor stage and lymphatic metastasis in Chinese Han population
25448675 FRMD5 regulates tumor cell motility via a dual pathway involving FRMD5 binding to integrin beta5 tail and to ROCK1
25150423 Immunohistochemical analysis for alphavbeta3, alphavbeta5 and alphavbeta6 integrin subunits was performed and correlated with Ki67 and hypoxia-inducible factor (HIF)-1alpha indexes
24997346 Myo7a interacts with integrin beta5 and selectively promotes integrin alphavbeta5-mediated cell migration
24899686 FAK activity regulates beta5 integrin expression and anchorage-independent cell growth in ovarian carcinoma.
24639195 Integrins alphavbeta5 and alphavbeta3 both control myofibroblast differentiation by activating latent TGF-beta1
24455718 we demonstrated via antibody blocking experiments that aV b5 and a6 significantly promoted hESC attachment in 2%oxygen only, whereas blockage of CD44 inhibited cell attachment in 21% O2 alone
24389192 findings suggest that Alpha(v)Beta5 integrins and their natural ligand VN are involved in P. fluorescens adherence and invasion in human epithelial cells
24294359 Brain metastases ITGB5 expression exhibits considerable heterogeneity according to tumor origin.
24036928 Integrin-beta5 and zyxin mediate formation of ventral stress fibers in response to transforming growth factor beta.
23984888 The top primary GWAS association of Airway hyperresponsiveness was in rs848788(P-value 7.2E-07) located within the ITGB5 genes.
23962022 molecular model of integrin b5 structure was prepared and stereo chemical model quality was checked. Integrin b5 active sites were identified based on insilico analysis tools.
23874483 BDNF enhances the migration of chondrosarcoma by increasing beta5 integrin expression through a signal transduction pathway that involves the TrkB receptor, PI3K, Akt, and NF-kappaB.
23462327 Data suggest that the integrin alphaVbeta5 receptor is largely responsible for mediating the differentiation process in pancreatic cells.
23269786 study demonstrate that binding of integrin alphavbeta5 and alpha defensin 5 have opposite effects on the elastic response of adenovirus type 35, revealing a direct link between virus-host interactions and the mechanical properties of the capsid
23261238 integrin alphavbeta5 might play an important role in invasion and metastases of laryngeal squamous cell carcinoma
23227240 CTGF increased IL-6 production in osteoarthritic synovial fibroblasts via the alphavbeta5 integrin, ASK1, p38/JNK, and AP-1/NF-kappaB signaling pathways.
23152803 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
23028753 Saccharomyces boulardii supernatant contains motogenic factors that enhance cell restitution through multiple pathways, including the dynamic fine regulation of alphavbeta5 integrin binding activity.
22879933 These studies implicate ASM as a mediator of apoptosis induced by inhibition of integrins alphavbeta3/alphavbeta5, and for the first time place c-Abl as an upstream regulator of ASM expression and activity.
22824793 Depletion of integrin beta5 in triple-negative breast carcinoma cells markedly reduced tumor take, growth and tumor angiogenesis, whereas reexpression of integrin beta5 rescued this phenotype; findings show a critical role for integrin beta5 in the tumorigenic potential of breast carcinoma cells
22692860 Data indicate the role of CYR61 and alpha(V)beta5 integrin as proteins that cooperate to mediate cancer cell migration.
22659470 Active MMP-2 regulates VEGF-A in melanoma cells on a transcriptional level via an integrin alphavbeta5/phosphoinositide-3-kinase-dependent pathway.
22566688 knockdown of endogenous alphavbeta5 expression or treatment with a function-blocking alphavbeta5 antibody significantly decreased stabilin-2-mediated phagocytosis in the absence of soluble factors
22561002 High beta5-integrin protein expression is associated with aggressive behavior in gastric cancer.
22547695 Cysteine-rich protein Cyr61 activates interleukin (IL)-6 production via the alphavbeta5/Akt/NF-kappaB signaling pathway in rheumatoid arthritis.
22503669 Letter: loss of integrin beta5 in polyomavirus positive Merkel cell carcinoma may influence cell adhesion/migration.
21978494 alphanubeta3 and alphanubeta5 have roles in photon-induced hypermigration of malignant glioma cells
21344378 CCN3 enhances the migration of chondrosarcoma cells by increasing MMP-13 expression through the alphavbeta3/alphavbeta5 integrin receptor, FAK, PI3K, Akt, p65, and NF-kappaB signal transduction pathway.
21098231 beta5 integrin is identified as the most important partner of the alpha vitronectin-coupled integrin dimer in monocyte-derived macrophages, thus rendering these cells more susceptible to NF-kappaB-dependent HIV-1 infection.
20719960 PAK4 is activated by cell attachment to vitronectin as mediated by PAK4 binding partner integrin alphavbeta5.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20626753 Data show that knockdown of integrin alphav and erbB3 by small-interfering RNAs significantly inhibited cell migration induced by HRG.
20615244 Integrin alphavbeta5 is a primary receptor for adenovirus.
20507994 p21-activated kinase 4 phosphorylation of integrin beta5 Ser-759 and Ser-762 regulates cell migration
20431064 Src kinase-mediated activation of STAT3 and subsequent angiogenic gene expression mediate the effects of integrin alpha v beta 5 and may be exploited to enhance the paracrine activities of circulating angiogenic cells.
20404485 The beta5-integrin adhesions contribute to the TGFbeta-induced EMT and the tumorigenic potential of carcinoma cells.
20400979 Ovarian cancer ascites induces FAK and Akt activation in an alphavbeta5 integrin-dependent pathway, which confers protection from TRAIL-induced cell death and caspase activation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20026907 Definitive endoderm highly express the integrins alphaV and beta5, which have the ability to bind to vitronectin.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910644 The angiogenic effects of leptin are mediated by circulating angiogenic cells and involve src kinase dependent phosphorylation of integrin alphavbeta5.
19811096 Beta1 integrins are required for adhesion and proliferation of induced pluripotent stem cells on Matrigel. On vitronectin, the integrin alphavbeta5 is required for initial attachment, but both alphavbeta5 and beta1 is required for proliferation.
19695571 Periostin mediates vascular smooth muscle cell migration through the integrins alphavbeta3 and alphavbeta5 and focal adhesion kinase (FAK) pathway
19502044 Observational study of gene-disease association. (HuGE Navigator)
19267182 Compound 4, having the DGR retro-sequence, is a low micromolar ligand for the alphavbeta5 integrin.
19255147 The active site within the Sdc1 core protein was identified and a peptide inhibitor called synstatin (SSTN) that disrupts Sdc1's interaction with alpha(v)beta(3) and alpha(v)beta(5) integrins was derived.
18844213 urokinase-derived antagonists of alphavbeta5 integrin activation inhibit migration and invasion of carcinoma cells
18648521 human umbilical vein endothelial cells adhere to immobilized CXCL4 through alphavbeta3 integrin, and also through other integrins, such as alphavbeta5 and alpha5beta1
18590706 Oxidized LDL impairs angiogenic properties of endothelial progenitor cells at sub-apoptotic levels by downregulation of E-selectin and integrin alphavbeta5, both substantial mediators of EPC-endothelial cell
18550570 Observational study of gene-disease association. (HuGE Navigator)
18445685 data identify PAI1 as a novel regulator of fibronectin matrix assembly, and indicate that this regulation occurs through a previously undescribed crosstalk between the alphavbeta5 and alpha5beta1 integrins
18162078 Real-time PCR showed that ETOH significantly altered the expression of genes involved in cell adhesion. There was an increase in the expression of alpha and beta Laminins 1, beta Integrins 3 and 5, Secreted phosphoprotein1 and Sarcoglycan epsilon.
17963729 Our studies suggest that the phagocytic function of beta5 integrin is regulated by an unconventional NPxY-talin-independent activation signal and argue for the existence of molecular switches in the beta5 cytoplasmic tail for adhesion and phagocytosis.
17074516 Cell surface expression of alphavbeta5 resulted in an attenuation of alphavbeta3-mediated migration on vitronectin
16675963 upregulated expression of alphavbeta5 contributes to autocrine TGF-beta signaling in localized scleroderma fibroblasts
16672769 Alphavbeta5 integrin may play a role in the adhesion and migration of VSMCs during the pathogenesis of atherosclerosis.
16614246 While tolerogenic DCs are not induced via alphavbeta5, coligation of CR3 and alphavbeta5 maintains the DC's tolerogenic profile.
16385340 Expression of integrins alphavbeta1, alphavbeta3, and alphavbeta5 in cerebral arteriovenous malformations and cavernous malformations. (Integrins alphavbeta1, alphavbeta3, and alphavbeta5)
16005200 integrin alphavbeta6, alphavbeta3, alphavbeta5, alpha5beta1 and alpha9beta1 binding to osteopontin is controlled by specific structural motifs that are recognized by extracellular proteases
15979906 different beta5 integrins: repeated-FNK (FNKFNK764-769) and single-FNK (FNK764-766) amino acid sequences in the cytoplasmic domain.
15866865 urokinase receptor-derived SRSRY peptide regulates cross-talk between fMLP and vitronectin receptors
15456946 Data suggest that modulating the expression of integrin subunits beta3/5 in human neurons may enhance adenoviral infectivity via the coxsackie-adenovirus receptor.
14741360 alphav subunit cleavage is essential for integrin function and has a considerable impact on integrin-dependent events, especially those leading to cell migration
12270930 identification of a new alphavbeta5 integrin-interacting motif that is highly conserved in the fas-1 domains of many proteins suggesting that fas-1 domain-containing proteins may perform their biological functions by interacting with integrins
11877043 Overexpression of the beta5 integrin in hematopoietic cells was associated with the inhibition of cell proliferation and apoptosis.
10438928 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
8757599 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
7682219 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins

AA Sequence 

MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANL      1 - 70
VKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDL     71 - 140
YYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPN    141 - 210
CVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDV    211 - 280
PHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTA    281 - 350
LIPGTTVEILDGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD    351 - 420
TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECS    421 - 490
PGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEFGKIYGPFCECDNFSCARNKG    491 - 560
VLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGEMCEKCPT    561 - 630
CPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELP    631 - 700
SGKSNLTVLREPECGNTPNAMTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMAS    701 - 770
NPLYRKPISTHTVDFTFNKFNKSYNGTVD                                             771 - 799
//

Text Mined References (113)

PMID Year Title
26244551 2015 ?v?5 Integrin/FAK/PGC-1? Pathway Confers Protective Effects on Retinal Pigment Epithelium.
25472585 2015 Association between polymorphisms of microRNA-binding sites in integrin genes and gastric cancer in Chinese Han population.
25448675 2014 FERM domain-containing protein FRMD5 regulates cell motility via binding to integrin ?5 subunit and ROCK1.
25150423 2014 ?v?3, ?v?5 and ?v?6 integrins in brain metastases of lung cancer.
25063885 2014 KSHV attachment and entry are dependent on ?V?3 integrin localized to specific cell surface microdomains and do not correlate with the presence of heparan sulfate.
24997346 2014 FERM domain-containing unconventional myosin VIIA interacts with integrin ?5 subunit and regulates ?v?5-mediated cell adhesion and migration.
24899686 2014 FAK Inhibition disrupts a ?5 integrin signaling axis controlling anchorage-independent ovarian carcinoma growth.
24639195 2014 Integrins ?v?5 and ?v?3 promote latent TGF-?1 activation by human cardiac fibroblast contraction.
24455718 2013 ?V ?5 and CD44 are oxygen-regulated human embryonic stem cell attachment factors.
24389192 2014 Alpha(v)beta5 integrins mediates Pseudomonas fluorescens interaction with A549 cells.
24294359 2013 Comparing the expression of integrins ?v?3, ?v?5, ?v?6, ?v?8, fibronectin and fibrinogen in human brain metastases and their corresponding primary tumors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24036928 2013 Integrin-?5 and zyxin mediate formation of ventral stress fibers in response to transforming growth factor ?.
23984888 2013 ITGB5 and AGFG1 variants are associated with severity of airway responsiveness.
23962022 2013 Structural insights into the extra cellular segment of integrin?5 and molecular interaction studies.
23874483 2013 ?5 integrin up-regulation in brain-derived neurotrophic factor promotes cell motility in human chondrosarcoma.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23462327 2013 The differentiation of pancreatic tumor-initiating cells by vitronectin can be blocked by cilengitide.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23269786 2013 Integrin and defensin modulate the mechanical properties of adenovirus.
23261238 2013 Elevated expression of integrin ?v and ?5 subunit in laryngeal squamous-cell carcinoma associated with lymphatic metastasis and angiogenesis.
23227240 2012 CTGF increases IL-6 expression in human synovial fibroblasts through integrin-dependent signaling pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
23028753 2012 Saccharomyces boulardii improves intestinal epithelial cell restitution by inhibiting ?v?5 integrin activation state.
22879933 2012 c-Abl is an upstream regulator of acid sphingomyelinase in apoptosis induced by inhibition of integrins ?v?3 and ?v?5.
22824793 2013 Integrin ?5 contributes to the tumorigenic potential of breast cancer cells through the Src-FAK and MEK-ERK signaling pathways.
22692860 2012 The matrix protein CCN1/CYR61 is required for ?(V)?5-mediated cancer cell migration.
22659470 2012 Highly invasive melanoma cells activate the vascular endothelium via an MMP-2/integrin ?v?5-induced secretion of VEGF-A.
22566688 2012 Cross talk between engulfment receptors stabilin-2 and integrin ?v?5 orchestrates engulfment of phosphatidylserine-exposed erythrocytes.
22561002 2012 Mitochondrial dysfunction promotes cell migration via reactive oxygen species-enhanced ?5-integrin expression in human gastric cancer SC-M1 cells.
22547695 2012 Cyr61 induces IL-6 production by fibroblast-like synoviocytes promoting Th17 differentiation in rheumatoid arthritis.
22503669 2012 Lack of integrin ?5 in Merkel cell carcinomas and derived cell lines is frequently associated with Merkel cell polyomavirus positivity.
21978494 2011 Targeting ???3 and ???5 inhibits photon-induced hypermigration of malignant glioma cells.
21642953 2011 Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21397862 2011 Angiopoietin-like 4 protein elevates the prosurvival intracellular O2(-):H2O2 ratio and confers anoikis resistance to tumors.
21344378 2011 CCN3 increases cell motility and MMP-13 expression in human chondrosarcoma through integrin-dependent pathway.
21098231 2011 ?5 integrin is the major contributor to the ?Vintegrin-mediated blockade of HIV-1 replication.
20719960 2010 Integrin-mediated cell attachment induces a PAK4-dependent feedback loop regulating cell adhesion through modified integrin alpha v beta 5 clustering and turnover.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626753 2010 Significance of integrin ?v?5 and erbB3 in enhanced cell migration and liver metastasis of colon carcinomas stimulated by hepatocyte-derived heregulin.
20615244 2010 Integrin alphavbeta5 is a primary receptor for adenovirus in CAR-negative cells.
20507994 2010 p21-activated kinase 4 phosphorylation of integrin beta5 Ser-759 and Ser-762 regulates cell migration.
20431064 2010 Overexpression of integrin beta 5 enhances the paracrine properties of circulating angiogenic cells via Src kinase-mediated activation of STAT3.
20404485 2010 Role of ?5-integrin in epithelial-mesenchymal transition in response to TGF-?.
20400979 2010 Ovarian cancer ascites protects from TRAIL-induced cell death through alphavbeta5 integrin-mediated focal adhesion kinase and Akt activation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20026907 Definitive endoderm derived from human embryonic stem cells highly express the integrin receptors alphaV and beta5.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910644 2010 Leptin enhances the potency of circulating angiogenic cells via src kinase and integrin (alpha)vbeta5: implications for angiogenesis in human obesity.
19811096 2010 Roles of integrins in human induced pluripotent stem cell growth on Matrigel and vitronectin.
19695571 2010 Periostin mediates vascular smooth muscle cell migration through the integrins alphavbeta3 and alphavbeta5 and focal adhesion kinase (FAK) pathway.
19502044 2009 Role of genetic susceptibility to latent adenoviral infection and decreased lung function.
19267182 2010 Cyclic DGR-peptidomimetic containing a bicyclic reverse turn inducer as a selective alpha(v)beta (5) integrin ligand.
19255147 2009 Syndecan-1 regulates alphavbeta3 and alphavbeta5 integrin activation during angiogenesis and is blocked by synstatin, a novel peptide inhibitor.
18844213 2009 Inhibition of migration and invasion of carcinoma cells by urokinase-derived antagonists of alphavbeta5 integrin activation.
18648521 2008 The CXC-chemokine CXCL4 interacts with integrins implicated in angiogenesis.
18590706 2008 Oxidized low density lipoprotein impairs endothelial progenitor cell function by downregulation of E-selectin and integrin alpha(v)beta5.
18550570 2008 Polymorphisms in predicted microRNA-binding sites in integrin genes and breast cancer: ITGB4 as prognostic marker.
18445685 2008 PAI1 stimulates assembly of the fibronectin matrix in osteosarcoma cells through crosstalk between the alphavbeta5 and alpha5beta1 integrins.
18162078 2008 Ethanol increases fetal human neurosphere size and alters adhesion molecule gene expression.
17963729 2007 A NPxY-independent beta5 integrin activation signal regulates phagocytosis of apoptotic cells.
17074516 2007 Cell surface overexpression of alphavbeta5 integrin impedes alphavbeta3-mediated migration of the human ovarian adenocarcinoma cell line IGROV1.
16675963 2006 Involvement of alphavbeta5 integrin in the establishment of autocrine TGF-beta signaling in dermal fibroblasts derived from localized scleroderma.
16672769 2006 betaig-h3 triggers signaling pathways mediating adhesion and migration of vascular smooth muscle cells through alphavbeta5 integrin.
16614246 2006 The apoptotic-cell receptor CR3, but not alphavbeta5, is a regulator of human dendritic-cell immunostimulatory function.
16385340 2006 Expression of integrins in cerebral arteriovenous and cavernous malformations.
16005200 2005 Distinct structural requirements for binding of the integrins alphavbeta6, alphavbeta3, alphavbeta5, alpha5beta1 and alpha9beta1 to osteopontin.
15979906 2005 Adhesiveness of beta5 integrin variant lacking FNK767-769 is similar to that of the prototype containing FNKFNK764-769.
15866865 2005 Cross-talk between fMLP and vitronectin receptors triggered by urokinase receptor-derived SRSRY peptide.
15611078 2005 Integrin-dependent functions of the angiogenic inducer NOV (CCN3): implication in wound healing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456946 2004 Characterization of the expression of key adenoviral receptors CAR and integrin beta3/beta5 subunits on the membrane of human NT2 neurons.
15156152 2004 Myosin-X provides a motor-based link between integrins and the cytoskeleton.
14741360 2004 The endoproteolytic processing of alphavbeta5 integrin is involved in cytoskeleton remodelling and cell migration.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627618 2003 Smooth muscle contraction and relaxation.
12769841 2003 Alpha v beta 5 integrin-dependent programmed cell death triggered by a peptide mimic of annexin V.
12606711 2003 Integrin beta cytoplasmic domain interactions with phosphotyrosine-binding domains: a structural prototype for diversity in integrin signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12358597 2003 The integrin alphavbeta3 is a receptor for the latency-associated peptides of transforming growth factors beta1 and beta3.
12356872 2002 P21-activated kinase 4 interacts with integrin alpha v beta 5 and regulates alpha v beta 5-mediated cell migration.
12270930 2002 Identification of motifs in the fasciclin domains of the transforming growth factor-beta-induced matrix protein betaig-h3 that interact with the alphavbeta5 integrin.
11934885 2002 The anchoring protein RACK1 links protein kinase Cepsilon to integrin beta chains. Requirements for adhesion and motility.
11877043 2001 [Correlation of cell apoptosis induction with expression of human beta5 integrin on hematopoietic cells].
11462216 2001 Fertilin beta and other ADAMs as integrin ligands: insights into cell adhesion and fertilization.
11435317 2001 Intercellular adhesion molecule-4 binds alpha(4)beta(1) and alpha(V)-family integrins through novel integrin-binding mechanisms.
11331301 2001 An RGD sequence in the P2Y(2) receptor interacts with alpha(V)beta(3) integrins and is required for G(o)-mediated signal transduction.
11287419 2001 CYR61 stimulates human skin fibroblast migration through Integrin alpha vbeta 5 and enhances mitogenesis through integrin alpha vbeta 3, independent of its carboxyl-terminal domain.
11278329 2001 Tumor cell invasion is promoted by activation of protease activated receptor-1 in cooperation with the alpha vbeta 5 integrin.
11162558 2001 MDC-9 (ADAM-9/Meltrin gamma) functions as an adhesion molecule by binding the alpha(v)beta(5) integrin.
11146654 2000 alphavbeta5 integrin recruits the CrkII-Dock180-rac1 complex for phagocytosis of apoptotic cells.
10995448 2000 Expression and function of alpha(v)beta(3) and alpha(v)beta(5) integrins in the developing pancreas: roles in the adhesion and migration of putative endocrine progenitor cells.
10579726 1999 Enhancement of endothelial cell migration and in vitro tube formation by TAP20, a novel beta 5 integrin-modulating, PKC theta-dependent protein.
10537314 1999 Urokinase receptor interacts with alpha(v)beta5 vitronectin receptor, promoting urokinase-dependent cell migration in breast cancer.
10438928 1999 Inflammatory cytokines synergize with the HIV-1 Tat protein to promote angiogenesis and Kaposi's sarcoma via induction of basic fibroblast growth factor and the alpha v beta 3 integrin.
9531507 1998 cDNA cloning reveals two mouse beta5 integrin transcripts distinct in cytoplasmic domains as a result of alternative splicing.
9443892 1998 The alphavbeta5 integrin functions as an endocytic receptor for vitronectin.
9442085 1998 Rack1, a receptor for activated protein kinase C, interacts with integrin beta subunit.
8886177 1996 Alpha-V/beta-3 and alpha-V/beta-5 integrin distribution in neoplastic kidney.
8757599 1996 HIV-1-Tat protein promotes chemotaxis and invasive behavior by monocytes.
7689573 1993 A study of the structure, function and distribution of beta 5 integrins using novel anti-beta 5 monoclonal antibodies.
7682219 1993 A novel integrin specificity exemplified by binding of the alpha v beta 5 integrin to the basic domain of the HIV Tat protein and vitronectin.
7592829 1995 A biochemical characterization of the binding of osteopontin to integrins alpha v beta 1 and alpha v beta 5.
7525578 1994 Integrin alpha v beta 8. Interaction with vitronectin and functional divergence of the beta 8 cytoplasmic domain.
2371275 1990 Cloning of an integrin beta subunit exhibiting high homology with integrin beta 3 subunit.
2328726 1990 Cloning, primary structure and properties of a novel human integrin beta subunit.
2211615 1990 cDNA sequence of the human integrin beta 5 subunit.
1918165 1991 Expression of beta 1, beta 3, beta 4, and beta 5 integrins by human epidermal keratinocytes and non-differentiating keratinocytes.
1694173 1990 Purification and functional characterization of integrin alpha v beta 5. An adhesion receptor for vitronectin.