Property Summary

NCBI Gene PubMed Count 200
PubMed Score 165.73
PubTator Score 134.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cancer 2346 3.765 1.9

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 4.100 1.4e-08
astrocytic glioma 1.400 3.6e-03
posterior fossa group A ependymoma 3.200 1.4e-16
psoriasis -1.200 6.6e-04
glioblastoma 1.700 1.5e-02
osteosarcoma -2.810 3.4e-10
group 4 medulloblastoma -1.600 2.2e-03
medulloblastoma, large-cell -1.200 3.2e-03
pancreatic ductal adenocarcinoma liver m... 3.071 1.6e-02
non-small cell lung cancer 2.079 2.5e-13
lung cancer 2.500 2.1e-05
pancreatic cancer 1.900 1.4e-06
interstitial cystitis -1.300 7.5e-03
lung adenocarcinoma 1.200 4.0e-07
pediatric high grade glioma 1.300 1.0e-02
pilocytic astrocytoma 1.600 7.5e-05
lung carcinoma -1.100 2.0e-12
Down syndrome 1.100 1.4e-03

Protein-protein Interaction (10)

Gene RIF (135)

PMID Text
26646105 High vimentin and low beta4 integrin protein levels are associated with poor survival in oral squamous carcinoma patients.
26580203 PKD2 and RSK1 regulate integrin beta4 phosphorylation at threonine 1736 to stabilize keratinocyte cell adhesion and its hemidesmosomes.
26572585 Endothelial cell overexpression of mutant ITGB4 with specific tyrosines mutated to phenylalanine (Y1440, Y1526 Y1640, or Y1422) resulted in significantly attenuated CS-induced cytokine expression.
26549523 This study describes a pro-metastatic EGFR/Src-dependent beta4 integrin/FAK complex that is involved in breast cancer malignancy and is a novel therapeutic target for triple-negative breast cancer.
26395630 Changes in beta-integrins gene expression in human prostate cancer cells following ITGB4 knockdown.
26381405 integrin alpha6beta4 stimulates invasion by promoting autocrine EGFR signaling through transcriptional up-regulation of key EGFR family members and by facilitating HGF-stimulated EGFR ligand secretion
26350464 syndecans remain anchored to the alpha6beta4 integrin via its cytoplasmic domain, but the activation of cell motility is disrupted
26223322 These data suggest that the p53(R248) mutant endows ovarian cancer cells with increased adhesiveness and that integrin beta4 and Akt signalling are associated with the mutation-enhanced ovarian cancer-mesothelial cell adhesion.
26037302 ITGB4 stimulation leads to recruitment of 12-LOX from the cytosol to the membrane.
25997717 Analysis showed that ITGB4 and VCL were upregulated in exosomes derived from taxane-resistant prostate cancer cells suggesting them as useful markers for progression of prostate cancer associated with taxane-resistance.
25945837 Data indicate that IGF binding protein-3 (IGFBP-3) reduced transcription of a variety of integrins, especially integrin beta4.
25849406 The third and fourth fibronectin type III domains (FnIII-3,4) emerge as a structural and functional unit within the integrin beta 4.
25728941 Case Report: pyloric atresia-junctional epidermolysis bullosa syndrome with splicing abnormality of ITGB4 due to nucleotide substitutions far from splice site.
25599535 Data indicate that knockdown of integrin beta4 (ITGB4) reduced the migratory and invasive ability of pancreatic ductal adenocarcinoma cells.
25550552 Integrin alpha1 and beta4 are downregulated, following Dendrofalconerol A treatment, in H460 cells.
25531330 find that both Syk and LMP2A have an effect on ITGbeta4 cell surface expression
25472585 ITGA3, ITGA6, ITGB3, ITGB4 and ITGB5 are associated with gastric cancer susceptibility tumor stage and lymphatic metastasis in Chinese Han population.
25326539 By a loss-of-function assay, we elucidate a novel feed-forward signaling pathway, integrin beta4 --> PI3K --> Akt --> FAK, by which TR3 mediates HUVEC migration. Furthermore, TR3/Nur77 regulates the expression of integrin beta4 by targeting its promoter activity.
25234746 underexpressed in circulating (4D culture) cells relative to 2D culture cells
24851274 Data indicate that sphingosine 1-phosphate (S1P) and hepatocyte growth factor (HGF) induced transloaction of integrin beta4, S1P receptors S1PR2 and S1PR3 to endothelial cell membrane caveolin-enriched microdomains (CEMs).
24807042 Case Report: ITGB4 germline mutations in junctional epidermolysis bullosa without pylori atresia but profound genito-urinary involvement.
24740264 Mutations in the 5' flanking region result in reduced integrin beta4 expression, which is related to increased risk of asthma.
24533083 the diminishment of crosstalk between phosphorylated FAK and ITGB4 due to the down-regulation of Gli family transcription factors might play a pivotal role for inhibiting ovarian cancer progression
24418536 Cellular integrin alpha6beta4 complex is necessary for HPV16 infection in HaCaTs cells.
24149370 miR-21 is a key player in oncogenic EMT, its overexpression is controlled by the cooperation of genetic and epigenetic alterations, and its levels, along with ITGbeta4 and PDCD4 expression, could be exploited as a prognostic tool for CRC metastasis.
24007983 Both annexin A7 and integrin beta4 were essential for small molecule, 6-amino-2, 3-dihydro-3-hydroxymethyl-1, 4-benzoxazine-induced autophagy.
24006899 Two types of metastatic trait were found in OSCC: locoregional dissemination, which was reflected by high-ITGA3/CD9, and distant metastasis through hematogenous dissemination, uniquely distinguished by high-ITGB4/JUP.
23884246 beta4 and beta1 integrin protein and mRNA expression is elevated in PKP2-silenced keratinocytes.
23803695 The expression of MPS-1 and ITGB4 is associated with poor outcomes in gastric cancer patients.
23617461 beta4 integrin rs8669 genotyping may help to identify a subgroup of HER-3-negative, K-RAS wild-type colorectal cancer patients who are more likely to benefit from anti-EGFR treatment.
23611113 Necl-4 interacts in cis with integrin alpha6 beta4 through their extracellular regions and Necl-4 inhibited the phorbol ester-induced disassembly of hemidesmosomes
23499737 Post-translational regulation of beta4 by PTHrP (Parathyroid hormone-related protein) is mediated via attenuation of its proteolytic cleavage by caspases.
23496044 A report on the broad spectrum of clinical and morphological epidermolysis bullosa manifestations associated with novel alpha6beta4 integrin mutations.
23348745 Mechanistic studies indicated that mutant ITGB4 fails to promote transactivation of ErbB2 and c-Met in prostate tumor progenitor cells and cancer cell lines.
23212923 S1PR1 and ITGB4 transactivation are rate-limiting events in the transduction of HGF signals via a dynamic c-Met complex resulting in enhanced EC barrier integrity
23013259 study reports two new non-Herlitz junctional epidermolysis bullosa cases carrying two novel ITGB4 mutations - c.3040C>T in exon 26 and c.4975G>T in exon 37
22917688 Most actinic cheilitis cases showed reduced expression of integrin beta4 and superficially invasive squamous cell carcinoma lacked intergrin beta4 in the invasive front.
22865863 MAPK activation is increased when [Ca(2+)](i) is increased, suggesting that calcineurin activates an additional mechanism that counteracts MAPK-induced beta4 phosphorylation.
22673183 invasive breast cancer cells confer an anoikis-resistant phenotype on myofibroblasts during tissue remodeling by inducing laminin-332 upregulation and integrin beta4 neoexpression
22545078 Silencing of ITGB4 in airway epithelial cells resulted in impaired antigen presentation processes and suppressed T cell proliferation.
22496621 the expression of integrin beta(4) is upregulated to sensitize the cells to low concentrations of netrin-4 for maintaining cell proliferation.
22493440 data indicate that the alpha6beta4 integrin is a master regulator of transcription and translation of other integrin subunits and underscore its pivotal role in wound healing and cancer
22308039 beta4 can regulate SPARC expression and that SPARC is an effector of beta4-mediated invasion.
22049212 signaling from integrin alpha6beta4 facilitates lysophosphatidic acid- stimulated chemotaxis through preferential activation of RhoA, which, in turn, facilitates activation of Rac1
21969027 Mutational analysis disclosed compound heterozygosity for two novel nonsense mutations in the ITGB4 gene: c.600dupC/p.F201fsX14 and c.2533C>T/p.Q845X.
21963679 AexU effector protein of Aeromonas veronii is a novel type three secretion system effector which specifically inactivates Rac1 to disrupt actin cytoskeleton and has an alternative cytotoxic pathway through beta4-integrin mediation.
21769085 beta4 serine phosphorylation may have important role during squamous cell carcinoma invasion by destabilizing hemidesmosomes and facilitating migration.
21388972 curcumin inhibits alpha6beta4 signaling and functions by altering intracellular localization of alpha6beta4, thus preventing its association with signaling receptors such as EGFR.
21098729 There exists a mutual dependency between HLA-I and the integrin beta(4) subunit to stimulate the proliferation and migration of endothelial cells, which may be important in promoting transplant vasculopathy and tumor angiogenesis.
20955205 recurrent c.1938delC in ITGB4 is a founder mutation in junctional epidermolysis bullosa associated with pyloric atresia (JEB-PA), and genotyping of the mutation can be utilized for prenatal diagnosis of JEB-PA
20937830 CD151 controls Met-dependent neoplastic growth by enhancing receptor signaling through beta4 integrin-mediated pathways, independent of cell-substrate adhesion
20855525 Data describe how alpha6beta4 integrin selectively activates Fyn in response to receptor engagement, and show that both catalytic and noncatalytic functions of SHP2 are required for Fyn activation by alpha6beta4.
20729552 ZEB1 coordinately regulates laminin-332 and {beta}4 integrin expression altering the invasive phenotype of prostate cancer cells
20705595 Results provided compelling evidence that integrin beta4 was involved in the structural integrity and functional homeostasis of airway epithelial cells.
20695903 Data show that integrin alpha(6)beta(4) interacts with ErbB3 but not with ErbB1, ErbB2 or ErbB4, and enhances the heregulin-induced, ErbB3/ErbB2 heterodimer-mediated DNA synthesis, but not cell motility, in A549 cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20603614 ARRDC3 directly binds to a phosphorylated form of ITGbeta4 leading to its internalization, ubiquitination and ultimate degradation, and suppress breast cancer progression.
20512931 These findings highlight a novel negative regulatory role for integrin beta4 in endothelial cell inflammatory responses involving SHP-2-mediated MAPK signaling
20510671 this study suggests that downregulation of integrin beta4 is important for the development ozone stress-induced airway hyperresponsiveness, presumably because it causes increased oxidative damage and epithelial apoptosis.
20509141 Integrin beta4 mediates cell senescence in human umbilical vein endothelial cells.
20364299 upregulation of ITGB4 promotes wound repair ability and anti-oxidative ability
20307589 Data define a new model of integrin beta4-dependent PKB/Akt and ERK1/2 activation demonstrating the keratin filament as a structure necessary in signal transmission.
19923172 Chromatin immunoprecipitation assays confirmed that JunB/Fra-1 proteins interact in vivo with the beta4-integrin promoter and that JunB/Fra-1 promoter occupancy is reduced during keratinocyte differentiation as well as in HPV8 E2 positive keratinocytes
19913121 Observational study of gene-disease association. (HuGE Navigator)
19710103 upregulated expression in lung adenocarcinoma cells following bacterial infection
19670701 Expression of beta 4 integrin was irregular and detected mainly in the skin blister of dermatitis herpetiformis and bullous pemphigoid.
19597468 Beta4 integrin promotes osteosarcoma metastasis and interacts with ezrin.
19586553 the alpha6Bbeta4 integrin inhibits colon cancer cell proliferation and c-Myc activity and is significantly down-regulated in colon cancer cells relative to its alpha6Abeta4 counterpart
19567674 Consistent with in vitro findings, a strong correlation between beta(4) overexpression and HIPK2 inactivation by cytoplasmic relocalization was observed in wtp53-expressing breast carcinomas.
19403692 BPAG1e is required for efficient regulation of keratinocyte polarity and migration by determining the activation of Rac1.
19151752 results suggest that NEU1 is important in regulation of integrin beta4-mediated signaling, leading to suppression of metastasis
19138983 Curcumin inhibits breast cancer cell motility and invasion by directly inhibiting the function of alpha(6)beta(4) integrin, and suggest that curcumin can serve as an effective therapeutic agent in tumors that overexpress alpha(6)beta(4).
19124484 Integrin alpha6beta4 and NET1 coexpression is independently associated with the development of distant metastasis in breast cancer.
19094228 Observational study of gene-disease association. (HuGE Navigator)
19087978 Integrin beta-4 signaling plays a key role in mouse embryogenesis.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19061949 The data suggested that autophagy played a key role in Cd2+ induced endothelial dysfunction; integrin beta4, caveolin-1 and PC-PLC might be the targets of Cd2+ in vascular endothelial cells.
19005215 These data suggest an important role for beta4 integrin S(1424) in the gradual disassembly of hemidesmosomes induced by cell retraction.
18974120 results identify Y1494 as a major regulatory site for signaling from the alpha6beta4 integrin to promote tumor development and progression
18971471 Itgb4 protein remains expressed in the early stages of peripheral regeneration and subsequent myelination.
18959757 integrin beta4 is implicated in and associated with p53 in autophagy of lung cancer cells
18955862 ITGB4 mutation may induce a desquamative enteropathy in infancy without significant skin disease.
18940803 ZKSCAN3 regulates the expression of several genes favoring tumor progression including integrin beta 4 and VEGF
18824633 beta4 interacts with the extracellular environment through both stable and transient interactions and may be managed through a different endosomal trafficking pathway than alpha3.
18814027 alpha6beta4 integrin-FAK-p38MAPK pathway is invloved in modulation of LDH expression.
18550570 ITGB4 SNP seems to influence tumour aggressiveness and survival in breast cancer patients.
18550570 Observational study of gene-disease association. (HuGE Navigator)
18348258 Deletion of the first pair of fibronectin type III repeats of the integrin beta-4 gene is associated with epidermolysis bullosa, pyloric atresia and aplasia cutis congenita in the original Carmi syndrome patients.
18299254 A novel isochroman derivative inhibited apoptosis in vascular endothelial cells through depressing the levels of integrin beta4 and TP53.
18281537 beta4 expression in human breast cancer is restricted and associated with basal-like cancers
18270579 the alpha6beta4 integrin strongly influence Akt phosphorylation through ErbB-3 protein regulation
18224668 Increase in ITGB4 is associated with lymph node metastasis in squamous cell carcinoma of the tongue
17964297 integrin beta4 might mediate vascular endothelial cell senescence through depressing Ca(2+)-independent phosphatidylcholine-specific phospholipase C
17711859 analysis of the signaling functions of the beta4 integrin intracellular domain
17515951 Data show that in bullous pemphigoid, expression of beta4 integrin was irregular and was detected mainly in dermal part of the blister.
17314405 domain V of the gamma2 chain negatively regulates the integrin beta4 phosphorylation, probably through a syndecan-1-mediated signaling, leading to enhanced cell adhesion and suppressed cell motility
16965770 The role of PTHrP in breast cancer growth and metastasis may be mediated via upregulation of integrin alpha6beta4 expression and Akt activation, with consequent inactivation of GSK-3.
16914518 Both the beta4 integrin ligand-binding and cytoplasmic domains together with epidermal growth factor were required for the synergistic activation of a Rac-dependent signaling pathway that was essential for keratinocyte directional migration.
16870608 Ln-5 is an important regulator of ADPKD cell proliferation and cystogenesis; Ln-5 gamma(2) chain and Ln-5-alpha(6)beta(4) integrin interaction both contribute to these phenotypic changes
16740748 The results confirm the relevance of beta4 expression in mammary tumors and indicate this integrin as a relevant target for tumor therapy.
16707493 Slug regulates integrin alpha3, beta1, and beta4 expression and cell proliferation in human epidermal keratinocytes
16537545 EWI proteins EWI-2 and EWI-F, alpha3beta1 and alpha6beta4 integrins, and protein palmitoylation have contrasting effects on cell surface CD9 organization
16436605 PMP22 forms a complex with alpha6beta4 integrin in cultured colonic adenocarcinoma cells.
16258729 alpha6beta4 integrin is mobilized and activated durign carcinoma progression [review]
16007143 beta4ctd- form is lost from colon cancer cells, while the level of the wild-type form of beta4, which is functional for adhesion to laminin, is increased in primary tumors in relation with the expression of c-Myc
15817481 the CH1 domain of the plectin-ABD associates with the groove between the two FNIII domains of beta4
15707651 immunohistochemistry clearly demonstrated colocalisation between calcium activated chloride channel 2 and integrin beta4
15611341 The beta4 integrins is a functional connection between CD9, as evidenced by anti-CD9 antibody effects on beta4-dependent cell spreading.
15579904 alpha6beta4 can augment cell-cell adhesion and slow down haptotaxis over laminin-5
15542431 These results provide genetic evidence that alpha6beta4 signaling promotes the onset of the invasive phase of pathological angiogenesis
15387376 activation by E-selectin, thus modulating adhesion
15381079 Blockage of beta4 integrin activity by antagonizing antibody abrogated ATV-induced endothelial death.
15367640 high expression of HPV type 8 (HPV8) E2 in cultured primary keratinocytes leads to strong down-regulation of beta4-integrin expression levels
15304080 link between the ligation of the beta(4) integrin and beta(1) integrin-mediated cell adhesion in carcinoma and pre-carcinoma cells.
15302884 cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin
15194479 Results suggest that bacterial heat shock protein 60 may promote epithelial cell migration through activation of epidermal growth factor receptor and mitogen-activated protein kinases, and inhibition of alpha6beta4 integrin expression.
15161909 alpha(6)beta(4) has a generic influence on the invasion of carcinoma cells that is not specific to Met
15009117 Pyloric atresia-junctional epidermolysis bullosa syndrome is caused by mutations in this gene in a case report.
14602071 Data demonstrate that alpha6beta4 integrin mediates pancreatic epithelial cell adhesion to Netrin-1, whereas recruitment of alpha6beta4 and alpha3beta1 regulate the migration of putative pancreatic progenitors on Netrin-1.
14517202 compartmentalization in lipid rafts is necessary to couple the alpha6beta4 integrin to a palmitoylated src family kinases and promote EGF-dependent mitogenesis.
14512419 integrin beta4/calcium-activated chloride channel ligation elicits selective signaling via focal adhesion kinase to promote metastatic growth
12919677 Data show that macrophage stimulating protein (MSP) and its receptor (Ron) induce phosphorylation of both Ron and alpha6beta4 integrin, and result in activation of alpha3beta1 integrin.
12865436 extracellular domain of beta 4 integrin, through its ability to bind ligand, functions to integrate the divergent effects of growth factors on the cytoskeleton and adhesion receptors
12694355 This study revealed detailed topography of integrins in malignant tumours derived from intercalated acinar segment of salivary gland which might be useful their diagnosis , especially of fine-needle aspiration products or from incisional biopsy.
12499048 Results suggest that alpha6beta4 integrin-mediated interactions of astrocytes with beta(ig)-h3 transduce intracellular signals through the focal adhesion proteins, which may regulate certain aspects of astrocyte response to brain injury.
12429829 Data suggest that the stability of the interaction between alpha6beta4 and laminin-5 is influenced by the clustering of alpha6beta4 through the deposition of laminin-5 underneath the cells.
12168086 integrin beta4 expression is increased when ROR alpha is activated in prostate cancer cells
12167101 integrin beta-4 expression in thyroid carcinoma may play a role in the development of gross lymph node metastasis of papillary carcinomas.
12119179 Beta4 integrin and alpha3 integrin are cleaved by the HIV-1 protease in human embryonic fibroblasts
12105188 Integrin (alpha 6 beta 4) regulation of eIF-4E activity and VEGF translation (Integrin alpha6beta4)
12023052 The integrin beta4B and beta4C variants were found not to be expressed in a tissue-specific manner.
11886501 binding of beta 4 to plectin is essential for the proper formation and function of hemidesmosomes
11848444 Acute hyperglycaemia induces an up-regulation of seven major genes, four of which were not previously reported in the literature. Northern blot analyses, performed on these 4 genes, confirm macroarrays results for alphav, beta4, c-myc, and MUC18.
11809527 Reduction in integrin alpha6beta4 is related to changes seen during immortalization and malignant progression
8444901 Beta4 integrin and alpha3 integrin are cleaved by the HIV-1 protease in human embryonic fibroblasts

AA Sequence

MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRRCNTQAELLAA      1 - 70
GCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFELEVFEPLESPVDLYILMDFSN     71 - 140
SMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSVPQTDMRPEKLKEPWPNSDPPFSFKNVISLT    141 - 210
EDVDEFRNKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGI    211 - 280
MSRNDERCHLDTTGTYTQYRTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQE    281 - 350
DSSNIVELLEEAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDG    351 - 420
THVCQLPEDQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFVCGQCVCSEGWSGQTC    421 - 490
NCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDNFQCPRTSGFLCNDRGRCSMG    491 - 560
QCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGRCHCHQQSLYTDTICEINYSAIHPGLCEDLR    561 - 630
SCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLV    631 - 700
HKKKDCPPGSFWWLIPLLLLLLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMA    701 - 770
SDHLDTPMLRSGNLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTREC    771 - 840
AQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLKLTEKQVEQRA    841 - 910
FHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPAGTATLGRRLVN    911 - 980
ITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQP    981 - 1050
GEAWKELQVKLLELQEVDSLLRGRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQ   1051 - 1120
PPPHGDLGAPQNPNAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYC   1121 - 1190
DYEMKVCAYGAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV   1191 - 1260
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSIPIIP   1261 - 1330
DIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLLGEELDLRRVTWRLPPELIPRL   1331 - 1400
SASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGEHLVNGRMDFAFPGSTNSLHRMTTTSAAAYG   1401 - 1470
THLSPHVPHRVLSTSSTLTRDYNSLTRSEHSHSTTLPRDYSTLTSVSSHDSRLTAGVPDTPTRLVFSALG   1471 - 1540
PTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGR   1541 - 1610
EREGVITIESQVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEM   1611 - 1680
AQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSRAG   1681 - 1750
LFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTHMDQQFF   1751 - 1820
QT                                                                       1821 - 1822
//

Text Mined References (206)

PMID Year Title
26646105 2016 Vimentin-mediated regulation of cell motility through modulation of beta4 integrin protein levels in oral tumor derived cells.
26580203 2015 PKD2 and RSK1 Regulate Integrin ?4 Phosphorylation at Threonine 1736.
26572585 2015 Role of Integrin ?4 in Lung Endothelial Cell Inflammatory Responses to Mechanical Stress.
26549523 2015 An EGFR/Src-dependent ?4 integrin/FAK complex contributes to malignancy of breast cancer.
26395630 2015 Suppression of ITGB4 Gene Expression in PC-3 Cells with Short Interfering RNA Induces Changes in the Expression of ?-Integrins Associated with RGD-Receptors.
26381405 2015 Integrin ?6?4 Promotes Autocrine Epidermal Growth Factor Receptor (EGFR) Signaling to Stimulate Migration and Invasion toward Hepatocyte Growth Factor (HGF).
26350464 2015 Syndecan-1 and Syndecan-4 Capture Epidermal Growth Factor Receptor Family Members and the ?3?1 Integrin Via Binding Sites in Their Ectodomains: NOVEL SYNSTATINS PREVENT KINASE CAPTURE AND INHIBIT ?6?4-INTEGRIN-DEPENDENT EPITHELIAL CELL MOTILITY.
26223322 2015 Mutant p53 promotes ovarian cancer cell adhesion to mesothelial cells via integrin ?4 and Akt signals.
26037302 2015 Convergence of eicosanoid and integrin biology: 12-lipoxygenase seeks a partner.
25997717 2015 Integrin ?4 and vinculin contained in exosomes are potential markers for progression of prostate cancer associated with taxane-resistance.
25945837 2015 Insulin-like growth factor binding protein-3 inhibits cell adhesion via suppression of integrin ?4 expression.
25849406 2015 Combination of X-ray crystallography, SAXS and DEER to obtain the structure of the FnIII-3,4 domains of integrin ?6?4.
25808196 2015 Intensified antineoplastic effect by combining an HDAC-inhibitor, an mTOR-inhibitor and low dosed interferon alpha in prostate cancer cells.
25728941 2015 Splicing abnormality of integrin ?4 gene (ITGB4) due to nucleotide substitutions far from splice site underlies pyloric atresia-junctional epidermolysis bullosa syndrome.
25599535 2015 Upregulation of integrin ?4 promotes epithelial-mesenchymal transition and is a novel prognostic marker in pancreatic ductal adenocarcinoma.
25550552 2015 Dendrofalconerol A suppresses migrating cancer cells via EMT and integrin proteins.
25531330 2015 SYK interaction with ITG?4 suppressed by Epstein-Barr virus LMP2A modulates migration and invasion of nasopharyngeal carcinoma cells.
25472585 2015 Association between polymorphisms of microRNA-binding sites in integrin genes and gastric cancer in Chinese Han population.
25326539 2015 Orphan nuclear receptor TR3/Nur77 improves wound healing by upregulating the expression of integrin ?4.
25234746 2015 Circulating tumor cells from 4D model have less integrin beta 4 expression.
24851274 2014 Interaction of integrin ?4 with S1P receptors in S1P- and HGF-induced endothelial barrier enhancement.
24807042 2015 ITGB4-associated junctional epidermolysis bullosa without pylori atresia but profound genito-urinary involvement.
24740264 2014 Analysis on the relevance of asthma susceptibility with the alteration of integrin ? 4 expression.
24533083 2014 Down-regulation of Gli transcription factor leads to the inhibition of migration and invasion of ovarian cancer cells via integrin ?4-mediated FAK signaling.
24418536 2014 HPV16 infection of HaCaTs is dependent on ?4 integrin, and ?6 integrin processing.
24149370 2014 Epigenetic regulation of miR-21 in colorectal cancer: ITGB4 as a novel miR-21 target and a three-gene network (miR-21-ITG?4-PDCD4) as predictor of metastatic tumor potential.
24007983 2013 Relationship between annexin A7 and integrin ?4 in autophagy.
24006899 2013 ITGA3 and ITGB4 expression biomarkers estimate the risks of locoregional and hematogenous dissemination of oral squamous cell carcinoma.
23884246 2014 Plakophilin 2 affects cell migration by modulating focal adhesion dynamics and integrin protein expression.
23803695 2013 Metallopanstimulin-1 regulates invasion and migration of gastric cancer cells partially through integrin ?4.
23617461 2013 Role of ?4 integrin in HER-3-negative, K-RAS wild-type metastatic colorectal tumors receiving cetuximab.
23611113 2013 Interaction of Necl-4/CADM4 with ErbB3 and integrin ?6 ?4 and inhibition of ErbB2/ErbB3 signaling and hemidesmosome disassembly.
23499737 2013 Parathyroid hormone-related protein regulates integrin ?6 and ?4 levels via transcriptional and post-translational pathways.
23496044 2013 Phenotypic spectrum of epidermolysis bullosa associated with ?6?4 integrin mutations.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23348745 2013 ?4 Integrin signaling induces expansion of prostate tumor progenitors.
23212923 2013 Critical role of S1PR1 and integrin ?4 in HGF/c-Met-mediated increases in vascular integrity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
23013259 2013 ITGB4-associated non-Herlitz junctional epidermolysis bullosa: report of two new cases carrying two novel ITGB4 mutations.
22917688 2012 Expression of laminin-5 and integrins in actinic cheilitis and superficially invasive squamous cell carcinomas of the lip.
22865863 2012 The calcium/calcineurin pathway promotes hemidesmosome stability through inhibition of ?4 integrin phosphorylation.
22673183 2012 Invasive breast cancer induces laminin-332 upregulation and integrin ?4 neoexpression in myofibroblasts to confer an anoikis-resistant phenotype during tissue remodeling.
22545078 2012 Downregulation of integrin ?4 decreases the ability of airway epithelial cells to present antigens.
22496621 2012 Netrin-4 promotes glioblastoma cell proliferation through integrin ?4 signaling.
22493440 2012 ?6?4 integrin, a master regulator of expression of integrins in human keratinocytes.
22351760 2012 Cross-talk between integrin ?6?4 and insulin-like growth factor-1 receptor (IGF1R) through direct ?6?4 binding to IGF1 and subsequent ?6?4-IGF1-IGF1R ternary complex formation in anchorage-independent conditions.
22314500 2012 Palmitoylation by DHHC3 is critical for the function, expression, and stability of integrin ?6?4.
22308039 2012 Integrin ?4 regulates SPARC protein to promote invasion.
22049212 2012 Integrin ?6?4 cooperates with LPA signaling to stimulate Rac through AKAP-Lbc-mediated RhoA activation.
21969027 2012 Lethal junctional epidermolysis bullosa with pyloric atresia due to compound heterozygosity for two novel mutations in the integrin ?4 gene.
21963679 2011 Recombinant AexU effector protein of Aeromonas veronii bv. sobria disrupts the actin cytoskeleton by downregulation of Rac1 and induces direct cytotoxicity to ?4-integrin expressing cell lines.
21880726 2011 Interaction of nectin-like molecule 2 with integrin alpha6beta4 and inhibition of disassembly of integrin alpha6beta4 from hemidesmosomes.
21769085 2011 Role of ?4 integrin phosphorylation in human invasive squamous cell carcinoma: regulation of hemidesmosome stability modulates cell migration.
21388972 2011 Curcumin inhibition of the functional interaction between integrin ?6?4 and the epidermal growth factor receptor.
21310825 2011 The androgen receptor induces integrin ?6?1 to promote prostate tumor cell survival via NF-?B and Bcl-xL Independently of PI3K signaling.
21269460 2011 Initial characterization of the human central proteome.
21098729 2010 HLA class I molecules partner with integrin ?4 to stimulate endothelial cell proliferation and migration.
20955205 2011 A founder effect of c.1938delC in ITGB4 underlies junctional epidermolysis bullosa and its application for prenatal testing.
20937830 2010 The tetraspanin CD151 is required for Met-dependent signaling and tumor cell growth.
20855525 2010 SHP2 mediates the localized activation of Fyn downstream of the ?6?4 integrin to promote carcinoma invasion.
20729552 2010 ZEB1 coordinately regulates laminin-332 and {beta}4 integrin expression altering the invasive phenotype of prostate cancer cells.
20705595 2010 Integrin beta4 was downregulated on the airway epithelia of asthma patients.
20695903 2010 Interaction of integrin alpha(6)beta(4) with ErbB3 and implication in heregulin-induced ErbB3/ErbB2-mediated DNA synthesis.
20682778 2010 Direct binding of the EGF-like domain of neuregulin-1 to integrins ({alpha}v{beta}3 and {alpha}6{beta}4) is involved in neuregulin-1/ErbB signaling.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20603614 2010 ARRDC3 suppresses breast cancer progression by negatively regulating integrin beta4.
20512931 2010 Integrin beta4 attenuates SHP-2 and MAPK signaling and reduces human lung endothelial inflammatory responses.
20510671 2010 Involvement of integrin beta4 in ozone stress-induced airway hyperresponsiveness.
20509141 2010 Modulation of vascular endothelial cell senescence by integrin ?4.
20364299 2010 Wound repair and anti-oxidative capacity is regulated by ITGB4 in airway epithelial cells.
20307589 2010 Ligation of beta4 integrins activates PKB/Akt and ERK1/2 by distinct pathways-relevance of the keratin filament.
19933311 2010 Characterization of integrin engagement during defined human embryonic stem cell culture.
19923172 2010 Human papillomavirus type 8 E2 protein unravels JunB/Fra-1 as an activator of the beta4-integrin gene in human keratinocytes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19710103 2010 Up-regulation of integrin expression in lung adenocarcinoma cells caused by bacterial infection: in vitro study.
19670701 2009 Expression of selected adhesion molecules in dermatitis herpetiformis and bullous pemphigoid.
19597468 2009 Beta4 integrin promotes osteosarcoma metastasis and interacts with ezrin.
19586553 2009 Integrin alpha6Bbeta4 inhibits colon cancer cell proliferation and c-Myc activity.
19567674 2009 Negative regulation of beta4 integrin transcription by homeodomain-interacting protein kinase 2 and p53 impairs tumor progression.
19403692 2009 BPAG1e maintains keratinocyte polarity through beta4 integrin-mediated modulation of Rac1 and cofilin activities.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19242489 2009 Structural basis of the interaction between integrin alpha6beta4 and plectin at the hemidesmosomes.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19151752 2009 Contribution of sialidase NEU1 to suppression of metastasis of human colon cancer cells through desialylation of integrin beta4.
19138983 2008 Curcumin inhibition of integrin (alpha6beta4)-dependent breast cancer cell motility and invasion.
19124484 2009 Coexpression of alpha6beta4 integrin and guanine nucleotide exchange factor Net1 identifies node-positive breast cancer patients at high risk for distant metastasis.
19094228 2008 The influence of genetic variation in 30 selected genes on the clinical characteristics of early onset breast cancer.
19087978 2009 Integrin beta-4 signaling plays a key role in mouse embryogenesis.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19061949 2009 Promotion of autophagy and inhibition of apoptosis by low concentrations of cadmium in vascular endothelial cells.
19005215 2009 Phosphorylation of a novel site on the {beta}4 integrin at the trailing edge of migrating cells promotes hemidesmosome disassembly.
18974120 2008 A key tyrosine (Y1494) in the beta4 integrin regulates multiple signaling pathways important for tumor development and progression.
18971471 2008 Conditional deletion of the Itgb4 integrin gene in Schwann cells leads to delayed peripheral nerve regeneration.
18959757 2008 Knockdown of integrin beta4-induced autophagic cell death associated with P53 in A549 lung adenocarcinoma cells.
18955862 2008 Desquamative enteropathy and pyloric atresia without skin disease caused by a novel intracellular beta4 integrin mutation.
18940803 2008 Unbiased screening for transcriptional targets of ZKSCAN3 identifies integrin beta 4 and vascular endothelial growth factor as downstream targets.
18824633 2009 Ultrastructural localization of integrin subunits beta4 and alpha3 within the migrating epithelial tongue of in vivo human wounds.
18814027 2009 Endothelial cell-laminin interaction: modulation of LDH expression involves alpha6beta4 integrin-FAK-p38MAPK pathway.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18550570 2008 Polymorphisms in predicted microRNA-binding sites in integrin genes and breast cancer: ITGB4 as prognostic marker.
18348258 2008 Deletion of the first pair of fibronectin type III repeats of the integrin beta-4 gene is associated with epidermolysis bullosa, pyloric atresia and aplasia cutis congenita in the original Carmi syndrome patients.
18299254 A novel isochroman derivative inhibited apoptosis in vascular endothelial cells through depressing the levels of integrin beta4, p53 and ROS.
18281537 2008 Analysis of integrin beta4 expression in human breast cancer: association with basal-like tumors and prognostic significance.
18270579 2008 Induction of ErbB-3 expression by alpha6beta4 integrin contributes to tamoxifen resistance in ERbeta1-negative breast carcinomas.
18224668 2008 Diagnostic value of integrin alpha3, beta4, and beta5 gene expression levels for the clinical outcome of tongue squamous cell carcinoma.
17964297 2007 Vascular endothelial cell senescence mediated by integrin beta4 in vitro.
17711859 2007 Intrinsic signaling functions of the beta4 integrin intracellular domain.
17515951 2007 Expression of selected integrins and selectins in bullous pemphigoid.
17314405 2007 The short arm of laminin gamma2 chain of laminin-5 (laminin-332) binds syndecan-1 and regulates cellular adhesion and migration by suppressing phosphorylation of integrin beta4 chain.
16965770 2006 PTH-related protein upregulates integrin alpha6beta4 expression and activates Akt in breast cancer cells.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16914518 2006 beta4 integrin and epidermal growth factor coordinately regulate electric field-mediated directional migration via Rac1.
16870608 2006 Laminin 5 regulates polycystic kidney cell proliferation and cyst formation.
16757171 2006 Current insights into the formation and breakdown of hemidesmosomes.
16740748 2006 Loss of beta4 integrin subunit reduces the tumorigenicity of MCF7 mammary cells and causes apoptosis upon hormone deprivation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16707493 2006 Slug regulates integrin expression and cell proliferation in human epidermal keratinocytes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16581764 2006 Multiple functions of the integrin alpha6beta4 in epidermal homeostasis and tumorigenesis.
16537545 2006 Contrasting effects of EWI proteins, integrins, and protein palmitoylation on cell surface CD9 organization.
16436605 2006 Peripheral myelin protein 22 is in complex with alpha6beta4 integrin, and its absence alters the Schwann cell basal lamina.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16258729 2005 Mobilization and activation of a signaling competent alpha6beta4integrin underlies its contribution to carcinoma progression.
16007143 2005 Upregulation of a functional form of the beta4 integrin subunit in colorectal cancers correlates with c-Myc expression.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15817481 2005 Modeling and experimental validation of the binary complex of the plectin actin-binding domain and the first pair of fibronectin type III (FNIII) domains of the beta4 integrin.
15707651 2005 The quantification of hCLCA2 and colocalisation with integrin beta4 in stratified human epithelia.
15611341 2004 Palmitoylation supports assembly and function of integrin-tetraspanin complexes.
15579904 2005 Integrin alpha6beta4-erbB2 complex inhibits haptotaxis by up-regulating E-cadherin cell-cell junctions in keratinocytes.
15542431 2004 Integrin beta4 signaling promotes tumor angiogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15387376 2004 Adhesion of HT-29 colon carcinoma cells to endothelial cells requires sequential events involving E-selectin and integrin beta4.
15381079 2004 Beta4 integrin is involved in statin-induced endothelial cell death.
15367640 2004 The human papillomavirus type 8 E2 protein suppresses beta4-integrin expression in primary human keratinocytes.
15304080 2004 Ligation of the beta4 integrin triggers adhesion behavior of human keratinocytes by an "inside-out" mechanism.
15302884 2004 The cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin.
15194479 2004 Bacterial heat shock protein 60 may increase epithelial cell migration through activation of MAP kinases and inhibition of alpha6beta4 integrin expression.
15161909 2004 The Met receptor and alpha 6 beta 4 integrin can function independently to promote carcinoma invasion.
15121854 2004 Protein kinase C-alpha phosphorylation of specific serines in the connecting segment of the beta 4 integrin regulates the dynamics of type II hemidesmosomes.
15009117 2004 Pyloric atresia-junctional epidermolysis bullosa syndrome showing novel 594insC/Q425P mutations in integrin beta4 gene (ITGB4).
14602071 2003 Recognition of the neural chemoattractant Netrin-1 by integrins alpha6beta4 and alpha3beta1 regulates epithelial cell adhesion and migration.
14517202 2003 Compartmentalization of integrin alpha6beta4 signaling in lipid rafts.
14512419 2003 The interacting binding domains of the beta(4) integrin and calcium-activated chloride channels (CLCAs) in metastasis.
12919677 2003 The MSP receptor regulates alpha6beta4 and alpha3beta1 integrins via 14-3-3 proteins in keratinocyte migration.
12865436 2003 Alpha 6 beta 4 integrin regulates keratinocyte chemotaxis through differential GTPase activation and antagonism of alpha 3 beta 1 integrin.
12802069 2003 Interaction of the bullous pemphigoid antigen 1 (BP230) and desmoplakin with intermediate filaments is mediated by distinct sequences within their COOH terminus.
12694355 2003 Salivary gland tumours: immunoexpression of integrins beta 1, beta 3 and beta 4.
12499048 2003 Transforming growth factor-beta-inducible gene-h3 (beta(ig)-h3) promotes cell adhesion of human astrocytoma cells in vitro: implication of alpha6beta4 integrin.
12485428 2002 Deletion of a cytoplasmic domain of integrin beta4 causes epidermolysis bullosa simplex.
12482924 2003 Analysis of the interactions between BP180, BP230, plectin and the integrin alpha6beta4 important for hemidesmosome assembly.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12441134 2002 Regulation of the association of alpha 6 beta 4 with vimentin intermediate filaments in endothelial cells.
12429829 2002 Dynamics of the alpha6beta4 integrin in keratinocytes.
12397374 2002 Crucial role of fibroblasts in regulating epidermal morphogenesis.
12168086 Role of the orphan nuclear receptor ROR alpha in the control of the metastatic behavior of androgen-independent prostate cancer cells.
12167101 2002 Increased expression of integrin beta-4 in papillary thyroid carcinoma with gross lymph node metastasis.
12110680 2002 Focal adhesion kinase activated by beta(4) integrin ligation to mCLCA1 mediates early metastatic growth.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
12105188 2002 Integrin (alpha 6 beta 4) regulation of eIF-4E activity and VEGF translation: a survival mechanism for carcinoma cells.
11884516 2002 Association of the tetraspanin CD151 with the laminin-binding integrins alpha3beta1, alpha6beta1, alpha6beta4 and alpha7beta1 in cells in culture and in vivo.
11848444 2002 Acute hyperglycaemia induces changes in the transcription levels of 4 major genes in human endothelial cells: macroarrays-based expression analysis.
11809527 2002 Alteration of integrin expression relates to malignant progression of human papillomavirus-immortalized esophageal keratinocytes.
11733063 2001 A signaling adapter function for alpha6beta4 integrin in the control of HGF-dependent invasive growth.
11684709 2001 EGF-R signaling through Fyn kinase disrupts the function of integrin alpha6beta4 at hemidesmosomes: role in epithelial cell migration and carcinoma invasion.
11389095 2001 Protein kinase Cdelta-mediated phosphorylation of alpha6beta4 is associated with reduced integrin localization to the hemidesmosome and decreased keratinocyte attachment.
11375975 2001 The hemidesmosomal protein bullous pemphigoid antigen 1 and the integrin beta 4 subunit bind to ERBIN. Molecular cloning of multiple alternative splice variants of ERBIN and analysis of their tissue expression.
11328943 2001 Epidermolysis bullosa with congenital pyloric atresia: novel mutations in the beta 4 integrin gene (ITGB4) and genotype/phenotype correlations.
11320086 2001 The breast cancer beta 4 integrin and endothelial human CLCA2 mediate lung metastasis.
11289717 2001 Nine novel single-nucleotide polymorphisms in the integrin beta4 (ITGB4) gene in the Japanese population.
11251584 2001 Alpha 6 beta 4 integrin abnormalities in junctional epidermolysis bullosa with pyloric atresia.
11044453 2001 Tyrosine phosphorylation of the beta 4 integrin cytoplasmic domain mediates Shc signaling to extracellular signal-regulated kinase and antagonizes formation of hemidesmosomes.
10873890 2000 Congenital focal segmental glomerulosclerosis associated with beta4 integrin mutation and epidermolysis bullosa.
10811835 2000 The tetraspan molecule CD151, a novel constituent of hemidesmosomes, associates with the integrin alpha6beta4 and may regulate the spatial organization of hemidesmosomes.
10792571 2000 A homozygous missense mutation in the cytoplasmic tail of beta4 integrin, G931D, that disrupts hemidesmosome assembly and underlies Non-Herlitz junctional epidermolysis bullosa without pyloric atresia?
10727209 2000 Identification of 12-lipoxygenase interaction with cellular proteins by yeast two-hybrid screening.
10711425 2000 The tetraspanin CD9 associates with the integrin alpha6beta4 in cultured human epidermal keratinocytes and is involved in cell motility.
10671376 2000 Integrin binding specificity of laminin-10/11: laminin-10/11 are recognized by alpha 3 beta 1, alpha 6 beta 1 and alpha 6 beta 4 integrins.
10637308 2000 The N terminus of the transmembrane protein BP180 interacts with the N-terminal domain of BP230, thereby mediating keratin cytoskeleton anchorage to the cell surface at the site of the hemidesmosome.
10504457 1999 Accumulation of matrilysin (MMP-7) and macrophage metalloelastase (MMP-12) in actinic damage.
10484780 1999 Splicing modulation of integrin beta4 pre-mRNA carrying a branch point mutation underlies epidermolysis bullosa with pyloric atresia undergoing spontaneous amelioration with ageing.
10477766 1999 Protein kinase C-dependent mobilization of the alpha6beta4 integrin from hemidesmosomes and its association with actin-rich cell protrusions drive the chemotactic migration of carcinoma cells.
10428948 1999 Crystal structure of a tandem pair of fibronectin type III domains from the cytoplasmic tail of integrin alpha6beta4.
9892956 1998 Pyloric atresia-junctional epidermolysis bullosa syndrome: mutations in the integrin beta4 gene (ITGB4) in two unrelated patients with mild disease.
9837976 1998 Cloning and characterization of the human beta4-integrin gene promoter and enhancers.
9792864 1998 Novel ITGB4 mutations in lethal and nonlethal variants of epidermolysis bullosa with pyloric atresia: missense versus nonsense.
9660880 1998 Hemidesmosome formation is initiated by the beta4 integrin subunit, requires complex formation of beta4 and HD1/plectin, and involves a direct interaction between beta4 and the bullous pemphigoid antigen 180.
9546354 1998 Compound heterozygosity for missense (L156P) and nonsense (R554X) mutations in the beta4 integrin gene (ITGB4) underlies mild, nonlethal phenotype of epidermolysis bullosa with pyloric atresia.
9428518 1997 Activation of phosphoinositide 3-OH kinase by the alpha6beta4 integrin promotes carcinoma invasion.
9422533 1998 Epidermolysis bullosa with pyloric atresia: novel mutations in the beta4 integrin gene (ITGB4).
9374518 1997 Isolation of a novel beta4 integrin-binding protein (p27(BBP)) highly expressed in epithelial cells.
9344615 1997 Cleavage of beta 4 integrin by matrilysin.
9207246 1997 The unique cytoplasmic domain of the human integrin variant beta4E is produced by partial retention of intronic sequences.
9194858 1997 Genomic organization of the integrin beta 4 gene (ITGB4): a homozygous splice-site mutation in a patient with junctional epidermolysis bullosa associated with pyloric atresia.
9171350 1997 The coupling of alpha6beta4 integrin to Ras-MAP kinase pathways mediated by Shc controls keratinocyte proliferation.
9166594 1997 Genomic organization of the human integrin beta4 gene.
8444901 1993 Identification of a novel cell attachment domain in the HIV-1 Tat protein and its 90-kDa cell surface binding protein.
7982032 1994 A novel structural variant of the human beta 4 integrin cDNA.
7556090 1995 Signal transduction by the alpha 6 beta 4 integrin: distinct beta 4 subunit sites mediate recruitment of Shc/Grb2 and association with the cytoskeleton of hemidesmosomes.
7545057 1995 Integrin beta 4 mutations associated with junctional epidermolysis bullosa with pyloric atresia.
2649503 1989 Association of the VLA alpha 6 subunit with a novel protein. A possible alternative to the common VLA beta 1 subunit on certain cell lines.
2542022 1989 A novel integrin (alpha E beta 4) from human epithelial cells suggests a fourth family of integrin adhesion receptors.
2311578 1990 Cloning and sequence analysis of beta-4 cDNA: an integrin subunit that contains a unique 118 kd cytoplasmic domain.
2311577 1990 Amino acid sequence of a novel integrin beta 4 subunit and primary expression of the mRNA in epithelial cells.
2070796 1991 Molecular cloning of the human alpha 6 integrin subunit. Alternative splicing of alpha 6 mRNA and chromosomal localization of the alpha 6 and beta 4 genes.
1976638 1990 Epithelial integrin alpha 6 beta 4: complete primary structure of alpha 6 and variant forms of beta 4.