Property Summary

NCBI Gene PubMed Count 32
PubMed Score 20.17
PubTator Score 16.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.500 2.1e-02
ependymoma -1.800 3.3e-02
cutaneous lupus erythematosus -1.200 6.9e-03
atypical teratoid / rhabdoid tumor -1.200 5.2e-04
medulloblastoma -1.200 4.4e-04
medulloblastoma, large-cell -1.400 3.2e-03
primary pancreatic ductal adenocarcinoma 1.299 3.0e-03
adult high grade glioma -1.400 3.3e-04
Pick disease -1.300 2.3e-04
gastric carcinoma 1.100 3.1e-02
ductal carcinoma in situ -1.700 3.8e-03
invasive ductal carcinoma -2.400 1.1e-03
ovarian cancer 2.700 4.6e-05
pancreatic cancer 1.300 2.5e-04
dermatomyositis 1.300 4.9e-03

Gene RIF (11)

PMID Text
23695561 The cocrystal structure of ICAP1 in complex with krev interaction trapped protein (KRIT)1 is characterized here.
23317506 The structural basis for KRIT1 antagonized ICAP1-modulated integrin-beta1 activation.
22736399 Annexin A1 is associated with gastric cancer survival and promotes gastric cancer cell invasiveness through the formyl peptide receptor/extracellular signal-regulated kinase/integrin beta-1-binding protein 1 pathway.
20616313 Identify ICAP1 as a novel regulator to prevent excessive sprouting angiogenesis.
19124506 Observational study of gene-disease association. (HuGE Navigator)
18812969 integrin cytoplasmic domain-associated protein-1 alpha (icap1alpha) act concordantly to play a critical role in beta1-integrin-mediated cell proliferation.
17133355 TNF-alpha induced expression of c-IAP1 and c-IAP2 via MAP kinases, but not via NF-kappaB, and that MAP kinases participated in the inhibition of apoptosis by induction of c-IAPs in TNF-alpha-stimulated endothelial cells
15703214 ICAP-1 shuttles between the nucleus and cytoplasm in a beta1 integrin-dependent manner
15166238 beta(1) integrin viability signal in collagen matrices is transduced by focal adhesion kinase
11854171 Integrin-binding protein also interacts with Krit 1 protein, cause of CCM1. (ICAP-1, integrin cytoplasmic domain-associated protein 1)
11741908 Site-directed mutagenesis showed that Leu(135), Ile(138), and Ile(139) of Icap1 alpha, and Leu(82) and Tyr(144), are required for the Icap1 alpha-beta(1) integrin interaction

AA Sequence

MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGA      1 - 70
IEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIR     71 - 140
MVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP              141 - 200
//

Text Mined References (36)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23695561 2013 Cocrystal structure of the ICAP1 PTB domain in complex with a KRIT1 peptide.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23317506 2013 Mechanism for KRIT1 release of ICAP1-mediated suppression of integrin activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22736399 2012 Annexin A1 is associated with gastric cancer survival and promotes gastric cancer cell invasiveness through the formyl peptide receptor/extracellular signal-regulated kinase/integrin beta-1-binding protein 1 pathway.
21768292 2011 Osteoblast mineralization requires beta1 integrin/ICAP-1-dependent fibronectin deposition.
20616313 2010 Integrin cytoplasmic domain-associated protein-1 attenuates sprouting angiogenesis.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18812969 2008 Krit1 modulates beta 1-integrin-mediated endothelial cell proliferation.
17916086 2007 Krit 1 interactions with microtubules and membranes are regulated by Rap1 and integrin cytoplasmic domain associated protein-1.
17133355 2007 MAP kinase-dependent, NF-kappaB-independent regulation of inhibitor of apoptosis protein genes by TNF-alpha.
16741948 2006 Integrin cytoplasmic domain-associated protein-1 (ICAP-1) interacts with the ROCK-I kinase at the plasma membrane.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15703214 2005 Nuclear translocation of integrin cytoplasmic domain-associated protein 1 stimulates cellular proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15166238 2004 Focal adhesion kinase is upstream of phosphatidylinositol 3-kinase/Akt in regulating fibroblast survival in response to contraction of type I collagen matrices via a beta 1 integrin viability signaling pathway.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473654 2003 Disruption of focal adhesions by integrin cytoplasmic domain-associated protein-1 alpha.
11919189 2002 Integrin cytoplasmic domain-associated protein 1alpha (ICAP-1alpha ) interacts directly with the metastasis suppressor nm23-H2, and both proteins are targeted to newly formed cell adhesion sites upon integrin engagement.
11854171 2002 KRIT1 association with the integrin-binding protein ICAP-1: a new direction in the elucidation of cerebral cavernous malformations (CCM1) pathogenesis.
11807099 2002 The integrin cytoplasmic domain-associated protein ICAP-1 binds and regulates Rho family GTPases during cell spreading.
11741908 2002 Molecular basis for interaction between Icap1 alpha PTB domain and beta 1 integrin.
11741838 2001 Interaction between krit1 and icap1alpha infers perturbation of integrin beta1-mediated angiogenesis in the pathogenesis of cerebral cavernous malformation.
10827173 2000 Interactions of the low density lipoprotein receptor gene family with cytosolic adaptor and scaffold proteins suggest diverse biological functions in cellular communication and signal transduction.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9867804 1999 Interaction of the integrin beta1 cytoplasmic domain with ICAP-1 protein.
9813144 1998 Calcium/calmodulin-dependent protein kinase II controls integrin alpha5beta1-mediated cell adhesion through the integrin cytoplasmic domain associated protein-1alpha.
9281591 1997 ICAP-1, a novel beta1 integrin cytoplasmic domain-associated protein, binds to a conserved and functionally important NPXY sequence motif of beta1 integrin.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.