Property Summary

NCBI Gene PubMed Count 91
PubMed Score 1540.32
PubTator Score 583.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.400 3.5e-07
cutaneous lupus erythematosus 1.900 8.0e-03
psoriasis -1.600 3.4e-04
osteosarcoma -3.021 1.1e-05
glioblastoma 1.100 5.0e-05
non-small cell lung cancer -1.028 3.2e-14
interstitial cystitis 1.100 8.7e-03
invasive ductal carcinoma 1.200 1.7e-03
lung carcinoma -2.400 2.1e-24
mucosa-associated lymphoid tissue lympho... 1.436 2.2e-02
ductal carcinoma in situ 1.100 9.2e-03
facioscapulohumeral dystrophy 2.500 1.8e-03

Protein-protein Interaction (4)

Gene RIF (63)

PMID Text
26927560 Data show that the percentage of CD11c positive antigen presenting cells (CD11c(+) APCs) in the peripheral blood of active pulmonary tuberculosis (APT) patients was much higher than that in the controls.
26852488 Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria
26309367 High expression of CD11c decreased the risk of death and relapse, and may be regarded as an alternative indicator of favorable prognosis in patients with gastric cancer.
26306739 Data show that secreted aspartic protease 2 (Sap2) of Candida albicans inactivates human macrophage complement factor H (factor H), factor H-receptors CD11b/CD18 and CD11c/CD18.
26255872 the CD11c molecule possesses four different cellular patterns in the periprosthetic tissues.
26153037 Data suggest that blood neutrophils expressing CD11c antigen and EMR2 protein be considered as potential biomarkers for sepsis and systemic inflammatory response syndrome (SIRS), respectively.
25411967 three of these five genes (CXCL14, ITGAX, and LPCAT2) harbored polymorphisms associated with aggressive disease development in a human GWAS cohort consisting of 1,172 prostate cancer patients.
25361058 infiltration of MBP(+) and CD11c(+) innate immune cells show a significant association with phenotype and disease extent of non-asthmatic chronic rhinosinusitis
25278023 LFA-1 and CR4 alpha chain phosphorylation is needed for chemokine-induced cross-talk to VLA-4
25231265 beta2 integrins-mediated chemosensory adhesion and migration of polymorphonuclear leukocytes on the vascular graft surface, bacterial cellulose.
25155097 CD11a, CD11c, and CD18 gene polymorphisms and susceptibility to Behcet's disease in Koreans.
24129562 the phosphorylation site of CD11c as Ser-1158 is pivotal for adherence and phagocytosis.
24124148 Chronic myelomonocytic leukemia monocytes uniformly display a population of monocytes with CD11c underexpression.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, alpha X (ITGAX, complement component 3 receptor 4 subunit) expression by HIV-1 Vpr in Vpr transduced macrophages
23246582 Data indicate that the frequencies of CD11c, CD11c/CD86, HLA-DR/CD86, CD83 and CD80 were significantly high, while CD11c/HLA-DR was low in Hepatitis E infection.
23118428 PCOS is associated with increased CD11c expression.
22844116 Upon expression on surface of human embryonic kidney (HEK)293 cells, alphaXbeta2 supports adhesive, migratory and phagocytic activities of human cells toward Candida albicans.
22808111 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, alpha X (ITGAX, complement component 3 receptor 4 subunit) expression by HIV-1 Vpr in Vpr transduced macrophages
22539788 Mice lacking protein tyrosine phosphatase Shp1 specifically in dendritic cells (DCs) develop splenomegaly associated with more CD11c+ DCs.
22393018 analysis of complement recognition by integrin alphaXbeta2
22244783 CD11c+HLADR+ dendritic cells are present in human ovarian follicular fluid, and their maturity correlates with serum estradiol levels in response to gonadotropins.
22017400 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, alpha X (ITGAX, complement component 3 receptor 4 subunit) expression by HIV-1 Vpr in Vpr transduced macrophages
21874872 The data obtained suggest that spontaneous cell adhesion to fibrinogen is mediated to a greater extent by CD11b/CD18 integrins, while chemokine-stimulated adhesion and migration is mostly dependent on CD11c/CD18 molecules.
21666055 CD11c-positive dendritic cells of transgenic mice express natural killer (NK) cell marker NK1.1 in the thyroid, indicating their NK cell origin.
21362770 Two large cohorts of systemic sclerosis (SSc) patients of European Caucasian ancestry do not support the implication of ITGAM, ITGAX, and CD58 genes in the genetic susceptibility of SSc, although they were identified as autoimmune disease risk genes.
21273385 Mycobacterial hypersensitivity pneumonitis requires TLR9-MyD88 in lung CD11b+ CD11c+ cells
21257965 CD11c(HI)-expressing first-trimester decidual macrophages are associated with lipid metabolism and inflammation; CD11c(LO)-expressing macrophages are involved in extracellular matrix formation, muscle regulation and tissue growth.
21239711 CD56(bright)CD11c(positive) cells play a key role in the interleukin (IL)-18-mediated proliferation of gammadelta T cells.
21030716 During hypertriglyceridemia, monocytes internalize lipids, upregulate CD11c/CD18, and increase adhesion to VCAM-1.
20962850 Observational study of gene-disease association. (HuGE Navigator)
20888334 Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood.
20679211 Data revealed that alpha(X)beta(2) in the extended-open headpiece conformation had high affinity for ligand, whereas both the bent conformation and the extended-closed headpiece conformation represented the low affinity state.
20660331 CD11c expression is rare in MCL and may aid in differentiation of CD5+ B-cell neoplasms
20610651 CD11c-positive dendritic cells play an important role in CD8 T cell responses following replication-defective adenovirus serotype 5 immunization, but striking redundancy for innate cytokines and signaling is revealed.
20574620 Case Report: Possible acceleration of regression by antibiotic treatment in benign cephalic histiocytosis with infiltration of CD11a/CD11c+ macrophages.
20479115 CD141+ dendritic cells are the only cells in human blood that express the chemokine receptor XCR1 and respond to the specific ligand XCL1 by Ca2+ mobilization and potent chemotaxis.
20382884 Depletion of CD11c-positive dendritic cells (DCs) increases the susceptibility of CD11c-diphtheria toxin receptor transgenic mice to infection with cell-free virus in both CD4 cell and non-CD4 fractions.
20033057 Structure of an integrin with an alphaI domain, complement receptor type 4.
20032971 There was increased expression of CD11c in monocytes of responders to adalimumab monotherapy.
19910635 Diet-induced obesity increased CD11c in both adipose tissue and blood.
19800635 The combination of high environmental stress and low CNS serotonin lead to increased expression of the beta(2)-integrins CD11b and CD11c on monocyte cell surfaces.
19257981 Data show high expression of CD86 and CD11C, moderate expression of CD1a and CD123, low levels of CD83 on dendritic cells after induction by GM-CSF and IL-4.
19237023 CD11c levels decreased in response to anti-TB treatment. CD11c/Arg47Trp polymorphism is not associated with pulmonary tuberculosis.
19129174 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18580071 The CD11c antibody was both sensitive and specific for hairy cell leukemia, even in cases with minimal infiltration.
18541300 The differential involvement of CD11c and CD11b in adhesion and subsequent cytoskeletal changes in monocytes exposed to different conditions.
18386786 CD11c transgene identifies a discrete network of dendritic cells in mouse embryonic central nervous system and in postnatal brain cells.
18204098 Genome-wide association study of gene-disease association. (HuGE Navigator)
18047418 Expression of alpha10 increases during aggregate culture of mesenchymal stem cells in a chondrogenic medium.
17726260 These data indicate that AP-2 and Ets-1 regulated expression of integrin alpha10 plays a role in migration of malignant melanoma cells.
17726152 The results from this study present TANGO as a novel ligand for CD11c, regulating migratory processes of hematopoietic cells.
17045822 Negative stain electron microscopy was used to examine the conformational changes in the ectodomains required for activation of the leukocyte integrins alpha(X)beta(2) and alpha(L)beta(2).
16716806 expression of the CD11c gene is regulated by PLD1 and is enhanced by Se-MSC during PMA-induced U937 differentiation.
16037628 In DVT subjects, at baseline, the phenotypical expression of CD11b was decreased and that of CD11c was increased, and upon PMN activation in DVT subjects CD11b, CD11c and CD18 increased, while CD11a expression did not show any change
15900581 The maturation of dendritic cells induced by CD11c- T cells through TNF-alpha production appears to result in the efficient expansion and activation of killer cells.
15730520 Observational study of gene-disease association. (HuGE Navigator)
15665082 adhesion of human neutrophil granulocytes to fibrinogen is greatly increased by plasmin digestion in a mode where alphaXbeta2 dominates the integrin-dependent binding
12576324 abnormal expression of the CD11c gene characteristic of hairy cell leukemia is dependent upon activation of the proto-oncogenes ras and junD
12351396 myeloid dendritic cells containing this antigen are able to stimulate T lymphocytes
12100475 serum amyloid P component does not circulate in complex with C4-binding protein (CD11c antigen), fibronectin or any other major protein ligand
12083416 The presence of CR1 (CD35) and CR4 (CD1c/CD18) on HUVEC indicates that endothelial cells (EC) have the potential to bind C3b and iC3b, respectively, which both mediate biological effects in the course of complement activation.
11937543 Activation of the CD11c gene promoter is mediated by Puralpha during phorbol myristate acetate-induced differentiation of monocytic U937 cells.
1967280 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of integrin, alpha X (ITGAX, complement component 3 receptor 4 subunit) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCG      1 - 70
YSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPV     71 - 140
SRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSS    141 - 210
NPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAG    211 - 280
IIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELE    281 - 350
MAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL    351 - 420
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGG    421 - 490
QVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVL    491 - 560
GPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPA    561 - 630
EIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSL    631 - 700
SRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKN    701 - 770
CGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ    771 - 840
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTS    841 - 910
KTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQE    911 - 980
AVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGN    981 - 1050
LSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLL   1051 - 1120
ALITAVLYKVGFFKRQYKEMMEEANGQIAPENGTQTPSPPSEK                              1121 - 1163
//

Text Mined References (94)

PMID Year Title
26927560 2016 [The number of peripheral blood CD11c+ antigen presenting cells increases and their function strengthens in the patients with active pulmonary tuberculosis].
26852488 2015 [Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria].
26309367 2015 High expression of CD11c indicates favorable prognosis in patients with gastric cancer.
26306739 2015 Secreted aspartic protease 2 of Candida albicans inactivates factor H and the macrophage factor H-receptors CR3 (CD11b/CD18) and CR4 (CD11c/CD18).
26255872 2016 Expression of CD11c in periprosthetic tissues from failed total hip arthroplasties.
26153037 2015 Expression of CD11c and EMR2 on neutrophils: potential diagnostic biomarkers for sepsis and systemic inflammation.
25411967 2014 A systems genetics approach identifies CXCL14, ITGAX, and LPCAT2 as novel aggressive prostate cancer susceptibility genes.
25361058 2014 MBP-positive and CD11c-positive cells are associated with different phenotypes of Korean patients with non-asthmatic chronic rhinosinusitis.
25278023 2014 Specific phosphorylations transmit signals from leukocyte ?2 to ?1 integrins and regulate adhesion.
25231265 2015 ?2 integrins (CD11/18) are essential for the chemosensory adhesion and migration of polymorphonuclear leukocytes on bacterial cellulose.
25155097 2014 CD11a, CD11c, and CD18 gene polymorphisms and susceptibility to Behçet's disease in Koreans.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24129562 2013 Integrin CD11c/CD18 ?-chain phosphorylation is functionally important.
24124148 2013 Chronic myelomonocytic leukemia monocytes uniformly display a population of monocytes with CD11c underexpression.
23981064 2014 Mycobacterium tuberculosis infection of human dendritic cells decreases integrin expression, adhesion and migration to chemokines.
23246582 2013 Altered expressions of peripheral CD11c, CD80, CD83 markers and associations of HLA class II allele and haplotypes in self-limiting Hepatitis E infection.
23118428 2013 PCOS is associated with increased CD11c expression and crown-like structures in adipose tissue and increased central abdominal fat depots independent of obesity.
22844534 2012 Structure and binding interface of the cytosolic tails of ?X?2 integrin.
22844116 2012 Integrin ?X?? is a leukocyte receptor for Candida albicans and is essential for protection against fungal infections.
22539788 2012 Dendritic cell-specific ablation of the protein tyrosine phosphatase Shp1 promotes Th1 cell differentiation and induces autoimmunity.
22393018 2012 Molecular basis for complement recognition by integrin ?X?2.
22244783 2012 CD11c+HLADR+ dendritic cells are present in human ovarian follicular fluid, and their maturity correlates with serum estradiol levels in response to gonadotropins.
21874872 2011 [Participation of beta2-integrins CD11b/CD18 and CD11c/CD18 in adhesion and migration of cells on fibrinogen].
21763482 2011 VPS35 mutations in Parkinson disease.
21666055 2011 A critical role for dendritic cells in the formation of lymphatic vessels within tertiary lymphoid structures.
21362770 2011 Association study of ITGAM, ITGAX, and CD58 autoimmune risk loci in systemic sclerosis: results from 2 large European Caucasian cohorts.
21273385 2011 Mycobacterial hypersensitivity pneumonitis requires TLR9-MyD88 in lung CD11b+ CD11c+ cells.
21257965 2011 Two unique human decidual macrophage populations.
21239711 2011 Involvement of CD56brightCD11c+ cells in IL-18-mediated expansion of human ?? T cells.
21030716 2011 CD11c/CD18 expression is upregulated on blood monocytes during hypertriglyceridemia and enhances adhesion to vascular cell adhesion molecule-1.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20888334 2010 Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood.
20679211 2010 Requirement of open headpiece conformation for activation of leukocyte integrin alphaXbeta2.
20660331 2010 The role of CD11c expression in the diagnosis of mantle cell lymphoma.
20610651 2010 CD8+ T cell responses following replication-defective adenovirus serotype 5 immunization are dependent on CD11c+ dendritic cells but show redundancy in their requirement of TLR and nucleotide-binding oligomerization domain-like receptor signaling.
20574620 2010 Possible acceleration of regression by antibiotic treatment in benign cephalic histiocytosis with infiltration of CD11a/CD11c+ macrophages.
20563599 2010 Integrin expression and integrin-mediated adhesion in vitro of human multipotent stromal cells (MSCs) to endothelial cells from various blood vessels.
20479115 2010 Superior antigen cross-presentation and XCR1 expression define human CD11c+CD141+ cells as homologues of mouse CD8+ dendritic cells.
20382884 2010 Depletion of dendritic cells enhances susceptibility to cell-free infection of human T cell leukemia virus type 1 in CD11c-diphtheria toxin receptor transgenic mice.
20033057 2010 Structure of an integrin with an alphaI domain, complement receptor type 4.
20032971 2010 CD11c as a transcriptional biomarker to predict response to anti-TNF monotherapy with adalimumab in patients with rheumatoid arthritis.
19946888 2010 Defining the membrane proteome of NK cells.
19910635 2010 CD11c expression in adipose tissue and blood and its role in diet-induced obesity.
19800635 2010 Socioeconomic status moderates associations between CNS serotonin and expression of beta2-integrins CD11b and CD11c.
19257981 2009 [The biological characteristics of peripheral blood CD123+ myeloid dendritic cell].
19237023 2009 Expression of CDllc in blood monocytes as biomarker for favorable response to antituberculosis treatment.
19234460 2009 A point mutation in KINDLIN3 ablates activation of three integrin subfamilies in humans.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19129174 2009 Evaluation of imputation-based association in and around the integrin-alpha-M (ITGAM) gene and replication of robust association between a non-synonymous functional variant within ITGAM and systemic lupus erythematosus (SLE).
18580071 2008 A novel CD11c monoclonal antibody effective in formalin-fixed tissue for the diagnosis of hairy cell leukemia.
18541300 2008 Integrin CD11c contributes to monocyte adhesion with CD11b in a differential manner and requires Src family kinase activity.
18386786 2008 CD11c/EYFP transgene illuminates a discrete network of dendritic cells within the embryonic, neonatal, adult, and injured mouse brain.
18204098 2008 Association of systemic lupus erythematosus with C8orf13-BLK and ITGAM-ITGAX.
18047418 2007 Alpha10 integrin expression is up-regulated on fibroblast growth factor-2-treated mesenchymal stem cells with improved chondrogenic differentiation potential.
17726260 2007 Expression of integrin alpha10 is induced in malignant melanoma.
17726152 2007 Interactions of TANGO and leukocyte integrin CD11c/CD18 regulate the migration of human monocytes.
17045822 2006 Activation of leukocyte beta2 integrins by conversion from bent to extended conformations.
16716806 2006 Se-methylselenocysteine enhances PMA-mediated CD11c expression via phospholipase D1 activation in U937 cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16037628 2005 Deep venous thrombosis: behaviour of the polymorphonuclear leukocyte integrin pattern at baseline and after in vitro activation.
15900581 2005 Dendritic cell maturation by CD11c- T cells and Valpha24+ natural killer T-cell activation by alpha-galactosylceramide.
15730520 2005 Haplotype analysis of the CD11 gene cluster in patients with chronic Helicobacter pylori infection and gastric ulcer disease.
15665082 2005 Exposure of acidic residues as a danger signal for recognition of fibrinogen and other macromolecules by integrin alphaXbeta2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12576324 2003 CD11c gene expression in hairy cell leukemia is dependent upon activation of the proto-oncogenes ras and junD.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351396 2002 Myeloid blood CD11c(+) dendritic cells and monocyte-derived dendritic cells differ in their ability to stimulate T lymphocytes.
12208882 2002 The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.
12100475 2002 Serum amyloid p component does not circulate in complex with C4-binding protein, fibronectin or any other major protein ligand.
12083416 2002 Human umbilical vein endothelial cells express complement receptor 1 (CD35) and complement receptor 4 (CD11c/CD18) in vitro.
11937543 2002 During differentiation of the monocytic cell line U937, Pur alpha mediates induction of the CD11c beta 2 integrin gene promoter.
11845978 2001 Flow cytometry of peripheral blood and bone marrow cells from patients with hairy cell leukemia: phenotype of hairy cells, lymphocyte subsets and detection of minimal residual disease after treatment.
11840270 2002 Expression of endothelial cell-associated molecules in AML cells.
11799095 2002 Activation of leukocytes during the uteroplacental passage in preeclampsia.
11460493 2001 Recognition of fibrinogen by leukocyte integrins.
11369639 2001 Investigation of human spleen dendritic cell phenotype and distribution reveals evidence of in vivo activation in a subset of organ donors.
11174197 2001 Acquisition and alteration of adhesion molecules during cultured human mast cell differentiation.
9885225 1999 Reduced expression of adhesion molecules and cell signaling receptors by chronic lymphocytic leukemia cells with 11q deletion.
9598326 1998 Mapping of the human CD11c (ITGAX) and CD11d (ITGAD) genes demonstrates that they are arranged in tandem separated by no more than 11.5 kb.
9473377 1998 Beta2 integrin/ICAM expression in Crohn's disease.
9250811 1997 CD11c integrin gene promoter activity during myeloid differentiation.
9176697 1997 Dendritic cells in the T-cell areas of lymphoid organs.
8645576 1996 Photodynamic treatment of human endothelial cells promotes the adherence of neutrophils in vitro.
8598231 1996 Activated human platelets express beta2 integrin.
8573344 1995 Leukocyte integrins.
8045597 1994 Detection of cell-adhesion molecules on human liver-associated lymphocytes.
7621072 1995 CD23 regulates monocyte activation through a novel interaction with the adhesion molecules CD11b-CD18 and CD11c-CD18.
7512600 1994 The leukocyte integrin p150,95 (CD11c/CD18) as a receptor for iC3b. Activation by a heterologous beta subunit and localization of a ligand recognition site to the I domain.
3549901 1987 Purification and alpha subunit N-terminal sequences of human Mac-1 and p150,95 leukocyte adhesion proteins.
3327687 1987 cDNA cloning and complete primary structure of the alpha subunit of a leukocyte adhesion glycoprotein, p150,95.
3284962 1988 Chromosomal location of the genes encoding the leukocyte adhesion receptors LFA-1, Mac-1 and p150,95. Identification of a gene cluster involved in cell adhesion.
2303426 1990 Genomic structure of an integrin alpha subunit, the leukocyte p150,95 molecule.
1976870 1990 Integrin distribution and cytoskeleton organization in normal and malignant monocytes.